[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57321.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:89 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   39->82 PF04226 * Transgly_assoc 4.4e-08 35.7 42/48  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57321.1 GT:GENE BAD57321.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2633851..2634120) GB:FROM 2633851 GB:TO 2634120 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57321.1 LENGTH 89 SQ:AASEQ MWNAIVQIVGFLIIGVIIGFLARALKPGADKLNFKMTALLGMAGALIGGIVASLIGKGSITELNFWGFVFAVIAAIALLFLAPVLQGKR GT:EXON 1|1-89:0| TM:NTM 3 TM:REGION 4->26| TM:REGION 35->57| TM:REGION 64->85| SEG 5->21|ivqivgfliigviigfl| SEG 38->52|allgmagaliggiva| SEG 68->82|fvfaviaaiallfla| HM:PFM:NREP 1 HM:PFM:REP 39->82|PF04226|4.4e-08|35.7|42/48|Transgly_assoc| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 88-89| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccc //