[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57327.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.111.1
:209 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->207 1d2tA_ a.111.1.1 * 1.1e-16 25.0 %
:HMM:PFM   101->185 PF01569 * PAP2 8.4e-10 24.1 79/129  
:HMM:PFM   64->116 PF07399 * DUF1504 0.00065 28.3 53/438  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57327.1 GT:GENE BAD57327.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2641071..2641700) GB:FROM 2641071 GB:TO 2641700 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57327.1 LENGTH 209 SQ:AASEQ MLDQKLTGRAVVATLAALVTLTLPLTFPPGGGPTGVDRALADMVRTDPPAAIHRVLVAPSDGWLVVTLLLAAIAWFGWRRQWWRAATMLVVPEAAIALNTWVLKPLFDRPLHDYLAYPSGHTVHLVAVATTVVLLCDSARVRLAVAVAGVVACGAVVVGQVGMDYHYATDVVGGAAAALALGIAGCAAAERLAGSRRPARGPGHDDSVP GT:EXON 1|1-209:0| TM:NTM 5 TM:REGION 4->25| TM:REGION 57->78| TM:REGION 85->107| TM:REGION 131->153| TM:REGION 170->191| SEG 6->36|ltgravvatlaalvtltlpltfppgggptgv| SEG 121->135|htvhlvavattvvll| SEG 144->162|avavagvvacgavvvgqvg| SEG 173->189|ggaaaalalgiagcaaa| HM:PFM:NREP 2 HM:PFM:REP 101->185|PF01569|8.4e-10|24.1|79/129|PAP2| HM:PFM:REP 64->116|PF07399|0.00065|28.3|53/438|DUF1504| HM:SCP:REP 1->207|1d2tA_|1.1e-16|25.0|200/224|a.111.1.1|1/1|Acid phosphatase/Vanadium-dependent haloperoxidase| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 193-209| PSIPRED cccccccHHHHHHHHHHHHHHHHccEEccccccHHHHHHHHHHHcccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHEEEcccHHHHHHHHHHHHHHcccHHHcccccccEEEHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccc //