[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57333.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  122/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
b.26.1
:161 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->157 2kfuA PDBj 1e-56 75.8 %
:RPS:PDB   54->143 2affA PDBj 1e-22 26.7 %
:RPS:SCOP  54->143 1r21A  b.26.1.2 * 1e-22 26.7 %
:HMM:SCOP  14->155 1g3gA_ b.26.1.2 * 9e-31 35.2 %
:RPS:PFM   77->137 PF00498 * FHA 7e-08 49.2 %
:HMM:PFM   75->137 PF00498 * FHA 4.8e-23 41.3 63/68  
:BLT:SWISS 1->148 ODHI_CORJK 2e-54 75.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57333.1 GT:GENE BAD57333.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2647224..2647709 GB:FROM 2647224 GB:TO 2647709 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57333.1 LENGTH 161 SQ:AASEQ MSENKDPGYQETAAETTSVFRADFLNEVDASRSGEQTGEQPVQGVEGLPAGAALLVVKRGPNAGSRFLLDQPTTSAGRHPDSDIFLDDVTVSRRHAEFRQDDDTFQVVDVGSLNGTYVNREPVDSSELQNGDEVQIGKFRLVFLTGPRAQVNEPSAGAGSL GT:EXON 1|1-161:0| BL:SWS:NREP 1 BL:SWS:REP 1->148|ODHI_CORJK|2e-54|75.4|142/144| BL:PDB:NREP 1 BL:PDB:REP 5->157|2kfuA|1e-56|75.8|149/161| RP:PDB:NREP 1 RP:PDB:REP 54->143|2affA|1e-22|26.7|90/98| RP:PFM:NREP 1 RP:PFM:REP 77->137|PF00498|7e-08|49.2|61/68|FHA| HM:PFM:NREP 1 HM:PFM:REP 75->137|PF00498|4.8e-23|41.3|63/68|FHA| RP:SCP:NREP 1 RP:SCP:REP 54->143|1r21A|1e-22|26.7|90/100|b.26.1.2| HM:SCP:REP 14->155|1g3gA_|9e-31|35.2|142/164|b.26.1.2|1/1|SMAD/FHA domain| OP:NHOMO 195 OP:NHOMOORG 125 OP:PATTERN -------------------------------------------------------------------- -111311111111111111-111122111111211111322222223122222222121111213322111111122212122-----------------------------------------------------33333---231-------1----------1----------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------11111----1---------3------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111-1-----1-------------12-1--11-----------------------B6-1---------------------------------------------------------------2----------------------------------------------------------------------------------------------------------------------------------------------1----1---------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1-----------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 158 STR:RPRED 98.1 SQ:SECSTR cccccccTcccccEEEccEEccccccEEEEEEEEEEccccccccccccTTccEEEEEcTTccEEEEEEccccEEEEEccTTccEEcccTTcccccEEEEEccccEEEEEcccccccEETTEEccccEEcTTcEEEETTEEEEEEEcHHHHTTTTTccc### DISOP:02AL 1-50, 146-161| PSIPRED ccccccccccccccccEEEEEcccccccccccccccccccccccccccccccEEEEEEEcccccEEEEEcccEEEEEEcccccEEEcccccccEEEEEEEEccEEEEEEccccccEEEccEEcccEEcccccEEEEccEEEEEEccccccccccccccccc //