[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57338.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:208 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   45->182 2id3B PDBj 2e-15 42.3 %
:RPS:PDB   28->184 2dtzB PDBj 1e-08 11.5 %
:RPS:SCOP  28->62 1jt0A1  a.4.1.9 * 3e-07 17.1 %
:RPS:SCOP  102->182 2id3A2  a.121.1.1 * 6e-10 40.7 %
:HMM:SCOP  14->81 2id3A1 a.4.1.9 * 2.7e-12 33.8 %
:HMM:SCOP  82->204 2id3A2 a.121.1.1 * 2.5e-27 37.4 %
:HMM:PFM   26->68 PF00440 * TetR_N 1.3e-11 32.6 43/47  
:BLT:SWISS 30->183 YDES_BACSU 6e-10 21.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57338.1 GT:GENE BAD57338.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2653162..2653788) GB:FROM 2653162 GB:TO 2653788 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57338.1 LENGTH 208 SQ:AASEQ MQQELSLETSKRPGGRSARVRAAVRQATLDELVAHGYAGLTIDNVAQRSGVHKTTVYRRWGSPAGLVADALELAAEEAWPLPDTGDLTADLRALTAAVHTGFTDPDAGPVATAFVTAALQNPDAATALRAFYRARHHQSAEIVRRAVARGELGPEVDPEAVVRYAIAPVFHRLLITHEPVDETLTRHAADTAIAAARAGLLDRAPGRS GT:EXON 1|1-208:0| BL:SWS:NREP 1 BL:SWS:REP 30->183|YDES_BACSU|6e-10|21.4|154/100| SEG 16->27|rsarvraavrqa| SEG 64->78|aglvadalelaaeea| SEG 83->97|dtgdltadlraltaa| SEG 185->207|trhaadtaiaaaraglldrapgr| BL:PDB:NREP 1 BL:PDB:REP 45->182|2id3B|2e-15|42.3|137/189| RP:PDB:NREP 1 RP:PDB:REP 28->184|2dtzB|1e-08|11.5|156/182| HM:PFM:NREP 1 HM:PFM:REP 26->68|PF00440|1.3e-11|32.6|43/47|TetR_N| RP:SCP:NREP 2 RP:SCP:REP 28->62|1jt0A1|3e-07|17.1|35/71|a.4.1.9| RP:SCP:REP 102->182|2id3A2|6e-10|40.7|81/123|a.121.1.1| HM:SCP:REP 14->81|2id3A1|2.7e-12|33.8|68/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 82->204|2id3A2|2.5e-27|37.4|123/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 33 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- ----2---------1------1-----------111111--112-------------3--1------131--------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 75.5 SQ:SECSTR ###########################HHHHHHHccTTTccHHHHHHTTTccTTTccccHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHccccGGGHHHHHHHHTccccTTTTTTTHHHHHHHHHHHHHHHHHHHHTTccHccccHHHHHHHHHHHHHHHHHTTccccHHHH######################## DISOP:02AL 1-22, 203-208| PSIPRED cccccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccccc //