[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57340.1
DDBJ      :             hypothetical protein
Swiss-Prot:VGB_NOCFA    RecName: Full=Virginiamycin B lyase;         EC=4.2.99.-;AltName: Full=Streptogramin B lyase;

Homologs  Archaea  2/68 : Bacteria  36/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
b.68.9
:279 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   11->270 2qc5A PDBj 7e-45 34.2 %
:RPS:SCOP  13->240 1rwiA  b.68.9.1 * 4e-18 23.0 %
:HMM:SCOP  39->268 1rwiA_ b.68.9.1 * 7e-25 24.8 %
:RPS:PFM   129->263 PF10282 * Muc_lac_enz 6e-04 33.3 %
:HMM:PFM   133->167 PF08450 * SGL 0.00063 38.2 34/246  
:HMM:PFM   253->269 PF01436 * NHL 4e-06 52.9 17/28  
:BLT:SWISS 1->279 VGB_NOCFA e-164 100.0 %
:REPEAT 6|26->65|66->103|104->142|143->183|184->225|226->265

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57340.1 GT:GENE BAD57340.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2655311..2656150 GB:FROM 2655311 GB:TO 2656150 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57340.1 LENGTH 279 SQ:AASEQ MPEILEVVDVDGGPYGVTVDETGTLWFTLAARGAVGRLVDGTVETVALEPADGSPTVIMAEGDGAWFTEFRGNRIGRVEANGALSFLTAESPYGLCRAGDGGLWYTELSAGGVVHRAPDGTTTRHAVEGMPSMIAEAADGTVFVTLNQGNAVARITPDGQVRTTALPTAGAGPVGLATAADGAWFVELLAGQLGHVDRDGTVTEHPLPDRDARPHAVVVAPDGTVWFTEWAAARLGRRTADGEITELALPGAEPHGLAVAPDGTLWVAMESGALVHVRP GT:EXON 1|1-279:0| SW:ID VGB_NOCFA SW:DE RecName: Full=Virginiamycin B lyase; EC=4.2.99.-;AltName: Full=Streptogramin B lyase; SW:GN Name=vgb; OrderedLocusNames=NFA_24930; SW:KW Antibiotic resistance; Complete proteome; Lyase; Magnesium;Metal-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->279|VGB_NOCFA|e-164|100.0|279/279| GO:SWS:NREP 3 GO:SWS GO:0046677|"GO:response to antibiotic"|Antibiotic resistance| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| NREPEAT 1 REPEAT 6|26->65|66->103|104->142|143->183|184->225|226->265| BL:PDB:NREP 1 BL:PDB:REP 11->270|2qc5A|7e-45|34.2|260/298| RP:PFM:NREP 1 RP:PFM:REP 129->263|PF10282|6e-04|33.3|135/311|Muc_lac_enz| HM:PFM:NREP 2 HM:PFM:REP 133->167|PF08450|0.00063|38.2|34/246|SGL| HM:PFM:REP 253->269|PF01436|4e-06|52.9|17/28|NHL| RP:SCP:NREP 1 RP:SCP:REP 13->240|1rwiA|4e-18|23.0|226/256|b.68.9.1| HM:SCP:REP 39->268|1rwiA_|7e-25|24.8|230/0|b.68.9.1|2/2|NHL repeat| OP:NHOMO 42 OP:NHOMOORG 40 OP:PATTERN ------------------------------------------------------------------11 ----1--------------------2------11111--1---1--------------------1-1-11---------------------------------------------------------------------------------------------------------------------------------------------11----1-------------------------------------------------------------------------------------------------------------1---------------------------------------------------1-------1--------------------------1-----------------------1--------------------------------------------------------------111---------------1----------1------2--------1------------------------------------------------------------------------------------------11------------------------1-----------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------1-1-11------------------------------------------------------------------ ----------------1---------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 266 STR:RPRED 95.3 SQ:SECSTR ####EEccccTccEEEEEEcTTccEEEEETTTTEEEEETTccEEEEEcccTTccEEEEEEcTTcEEEEETTTTEEEEEcTTccEEEEEcccEEEEEEccTTcEEEEETTTTEEEEEcTTccEEEEEcccTEEEEEEcTTccEEEEETTTTEEEEEcTTccEEEEEcccTTccEEEEEEcTTccEEEETTTTEEEEEcTTccEEEEEcccTTccEEEEEEccTTcEEEEETTTTEEEEEcTTccEEEcccTTcccccEEEcTTccEEEEcc######### PSIPRED cccEEEEEcccccccEEEEcccccEEEEEEcccEEEEEEccccEEEEEcccccccEEEEEcccEEEEEEccccEEEEEEccccEEEEccccccEEEEcccccEEEEEccccEEEEcccccEEEEEEccccccEEEEcccccEEEEEEcccEEEEEEccccEEEEEccccccccEEEEEcccccEEEEEcccEEEEEEccccEEEEEEEcccccccEEEEcccccEEEEEccccEEEEEccccEEEEEEccccccEEEEEcccccEEEEEccccEEEEcc //