[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57345.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.106.1
:229 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->108 2f2eB PDBj 2e-05 33.0 %
:RPS:PDB   110->211 3cnuA PDBj 4e-12 10.8 %
:RPS:SCOP  8->98 1z7uA1  a.4.5.69 * 4e-17 25.3 %
:RPS:SCOP  101->211 2cfuA1  d.106.1.3 * 2e-17 21.6 %
:HMM:SCOP  5->108 2f2eA1 a.4.5.69 * 6.9e-27 47.6 %
:HMM:SCOP  108->211 1iktA_ d.106.1.1 * 1e-14 26.0 %
:RPS:PFM   21->95 PF01638 * HxlR 2e-06 34.7 %
:HMM:PFM   20->98 PF01638 * HxlR 3.3e-20 45.6 79/91  
:HMM:PFM   129->210 PF02036 * SCP2 5.9e-08 25.0 80/102  
:HMM:PFM   110->134 PF06812 * ImpA-rel_N 0.0008 28.0 25/62  
:BLT:SWISS 12->98 YDEP_BACSU 3e-08 28.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57345.1 GT:GENE BAD57345.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2660307..2660996 GB:FROM 2660307 GB:TO 2660996 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57345.1 LENGTH 229 SQ:AASEQ MPSPTAAYGQYCPIARALDLLGERWSLLILRDLLLGSTRFNDLSRGLPGLSRSLLAKRLRQFERAGLVEKVGIRYVPTQAGLDLEPVLFGLAEWGASWSFGAPDPAELDADLLVWWMHTRLDTTGLPGLRQVFAVRFTDDARRYWIVVDRGAPSVCVTDPGFPVDVTIRSDVASLYQVWLGRLPIGHAQRTGRLEFLGPPALTRRMSTILRLSPVAPYSATPLRMAETA GT:EXON 1|1-229:0| BL:SWS:NREP 1 BL:SWS:REP 12->98|YDEP_BACSU|3e-08|28.7|87/128| SEG 27->35|llilrdlll| SEG 43->55|lsrglpglsrsll| BL:PDB:NREP 1 BL:PDB:REP 12->108|2f2eB|2e-05|33.0|94/138| RP:PDB:NREP 1 RP:PDB:REP 110->211|3cnuA|4e-12|10.8|102/110| RP:PFM:NREP 1 RP:PFM:REP 21->95|PF01638|2e-06|34.7|75/91|HxlR| HM:PFM:NREP 3 HM:PFM:REP 20->98|PF01638|3.3e-20|45.6|79/91|HxlR| HM:PFM:REP 129->210|PF02036|5.9e-08|25.0|80/102|SCP2| HM:PFM:REP 110->134|PF06812|0.0008|28.0|25/62|ImpA-rel_N| RP:SCP:NREP 2 RP:SCP:REP 8->98|1z7uA1|4e-17|25.3|91/108|a.4.5.69| RP:SCP:REP 101->211|2cfuA1|2e-17|21.6|111/125|d.106.1.3| HM:SCP:REP 5->108|2f2eA1|6.9e-27|47.6|103/0|a.4.5.69|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 108->211|1iktA_|1e-14|26.0|104/115|d.106.1.1|1/1|Sterol carrier protein, SCP| OP:NHOMO 38 OP:NHOMOORG 36 OP:PATTERN -------------------------------------------------------------------- ----1------------11-12--2-111111-11111---1---1-------1--------1----1------------------------------------------------------------------------------1--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------11---------1-----------------------------------------------------------------------11--------------------------1-1-------------1------------------------------------------------------1-------------------------------------1--------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 202 STR:RPRED 88.2 SQ:SECSTR ###########cTTHHHHHHHccccH#HHHHHHHHTcccHHH#HHHHHTccHHHHHHHHHHHHHTTcEEEEcEEEEEcHHHHTTHHHHHHHHHHHHHHcc#cTTccccHHHHHHHHHHHHHHHcHHHHHTTccEEEEEETTEEEEEEEcTTccEEEEEcccccccEEEEccHHHHHHHHTTcccHHHHHHHTccEEEccHHHHHHHHHHHHccccc############# DISOP:02AL 1-8, 226-229| PSIPRED cccccccccccccHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHHcccEEccEEEccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccccEEEEEEEEEcccEEEEEEEEccccEEEccccccccEEEEEEcHHHHHHHHHccccHHHHHHcccEEEEccHHHHHHHHHHHHHcccccccccccHHHccc //