[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57347.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  145/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:212 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->203 3dcfB PDBj 1e-13 28.2 %
:RPS:PDB   25->204 3br6A PDBj 8e-24 17.8 %
:RPS:SCOP  25->88 1z77A1  a.4.1.9 * 5e-16 31.2 %
:RPS:SCOP  92->204 1pb6A2  a.121.1.1 * 1e-10 9.7 %
:HMM:SCOP  11->99 1t33A1 a.4.1.9 * 1.4e-19 40.9 %
:HMM:SCOP  94->206 1vi0A2 a.121.1.1 * 3.2e-17 31.0 %
:RPS:PFM   27->70 PF00440 * TetR_N 3e-07 50.0 %
:HMM:PFM   27->70 PF00440 * TetR_N 6.5e-19 61.4 44/47  
:HMM:PFM   108->162 PF09543 * DUF2379 0.00041 40.0 55/122  
:BLT:SWISS 27->123 YUXN_BACSU 7e-10 30.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57347.1 GT:GENE BAD57347.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2662317..2662955) GB:FROM 2662317 GB:TO 2662955 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57347.1 LENGTH 212 SQ:AASEQ MSEQPPTRRRGRPPASAAGAADTRERIVRAAVELFAEKGFHGTGVAEIGDRADVQRGALYYHIGSKEELLWQILHGYTALMLADAERITDGDDDPVAKLRKLIRSHVVLIIRHRREVAIQLRDVGALTGERAAQLQELRDRIQARWQRVFDAGHAAGLLRTADHVVTNSVLGMLNTVTLWYRPHGGRTPAEIADILAATVLDGVVTVSHTKG GT:EXON 1|1-212:0| BL:SWS:NREP 1 BL:SWS:REP 27->123|YUXN_BACSU|7e-10|30.9|97/291| SEG 5->24|pptrrrgrppasaagaadtr| BL:PDB:NREP 1 BL:PDB:REP 26->203|3dcfB|1e-13|28.2|170/181| RP:PDB:NREP 1 RP:PDB:REP 25->204|3br6A|8e-24|17.8|180/185| RP:PFM:NREP 1 RP:PFM:REP 27->70|PF00440|3e-07|50.0|44/47|TetR_N| HM:PFM:NREP 2 HM:PFM:REP 27->70|PF00440|6.5e-19|61.4|44/47|TetR_N| HM:PFM:REP 108->162|PF09543|0.00041|40.0|55/122|DUF2379| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00440|IPR001647| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00440|IPR001647| RP:SCP:NREP 2 RP:SCP:REP 25->88|1z77A1|5e-16|31.2|64/75|a.4.1.9| RP:SCP:REP 92->204|1pb6A2|1e-10|9.7|113/126|a.121.1.1| HM:SCP:REP 11->99|1t33A1|1.4e-19|40.9|88/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 94->206|1vi0A2|3.2e-17|31.0|113/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 297 OP:NHOMOORG 146 OP:PATTERN -------------------------------------------------------------------- --1-21-1--11--32222-23--16222221255566ED-4-3---------1-2-1--116--455432-----------2---------------------------------------------------------1-------------------------1----------------11122---111----------------1-------34311--------2-----------------------------------------------------------------------------------------------------------1---111-----1--1--------------------------------111---1-11---------------1--1---12-1-----1--1--14---112--21-11-------------1-1-------------------------------21--1A861--------------11111-12-213-1--11--1---2-33----1----11----------12--111-----1---------1--------2--1-------------------------------3---------------------------------------------------------------------------------------------------------------------------------------21-----------------111111------1111-1-31----1------------------------1--------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 183 STR:RPRED 86.3 SQ:SECSTR ########################HHHHHHHHHHHHHHcTTTccHHHHHHHTTccHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHGGGcccHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccccHHHHHHHHHHHHHHHHTcccccHHHHHHHHHHHHHHHHHTTGGc##### DISOP:02AL 1-25, 208-212| PSIPRED cccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccc //