[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57357.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:121 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   31->91 3cd5A PDBj 9e-05 26.8 %
:HMM:PFM   31->79 PF00368 * HMG-CoA_red 3.3e-05 34.1 44/374  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57357.1 GT:GENE BAD57357.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2673364..2673729) GB:FROM 2673364 GB:TO 2673729 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57357.1 LENGTH 121 SQ:AASEQ MQVLGLNVLHVDAQGTGADPATGTYVATGRLGNMPLPVRVTGPVTCLTINGNTVSLVYPITTAEPVMVFAPDSMAIQITVTKGENGEPNRIGYGIPMPTTSFRGCQPGPTPLIFDGTIDIS GT:EXON 1|1-121:0| RP:PDB:NREP 1 RP:PDB:REP 31->91|3cd5A|9e-05|26.8|56/425| HM:PFM:NREP 1 HM:PFM:REP 31->79|PF00368|3.3e-05|34.1|44/374|HMG-CoA_red| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 72 STR:RPRED 59.5 SQ:SECSTR ##############################cccccccEEEEEE###EEccccEEEEEEEEEcccTTHHHHHHHHHHHHHHTTccEEEEEEEEEEE#EEccEEEccc############### DISOP:02AL 1-2| PSIPRED cEEEcEEEEEEEcccccccccccEEEEEcccccccccEEEcccEEEEEEcccEEEEEEEEccccEEEEEccccEEEEEEEEEcccccccEEEEccccccccccccccccccEEEEEEEEEc //