[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57365.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  53/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:119 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->94 2g9wA PDBj 3e-33 82.0 %
:RPS:PDB   1->55 2co5B PDBj 3e-04 3.6 %
:RPS:SCOP  4->96 2g9wA1  a.4.5.39 * 4e-08 73.3 %
:HMM:SCOP  1->111 1sd4A_ a.4.5.39 * 3e-17 31.2 %
:RPS:PFM   1->92 PF03965 * Pencillinase_R 4e-14 45.6 %
:HMM:PFM   1->106 PF03965 * Pencillinase_R 1.5e-28 41.3 104/115  
:BLT:SWISS 1->117 BLAI_MYCTU 2e-41 82.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57365.1 GT:GENE BAD57365.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2683328..2683687) GB:FROM 2683328 GB:TO 2683687 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57365.1 LENGTH 119 SQ:AASEQ MDQLWSSDEPQTVRQVHEALAARRELAYTTVMTVLQRLAKKNLVVQRRDDRAHRYAPVHTRDELVASLMVDALQQAEEAGSRAAALVHFVEQVGPDEADALREALAKLEAAEGTSPPGE GT:EXON 1|1-119:0| BL:SWS:NREP 1 BL:SWS:REP 1->117|BLAI_MYCTU|2e-41|82.9|117/100| SEG 97->112|eadalrealakleaae| BL:PDB:NREP 1 BL:PDB:REP 1->94|2g9wA|3e-33|82.0|89/116| RP:PDB:NREP 1 RP:PDB:REP 1->55|2co5B|3e-04|3.6|55/94| RP:PFM:NREP 1 RP:PFM:REP 1->92|PF03965|4e-14|45.6|90/115|Pencillinase_R| HM:PFM:NREP 1 HM:PFM:REP 1->106|PF03965|1.5e-28|41.3|104/115|Pencillinase_R| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF03965|IPR005650| GO:PFM GO:0016481|"GO:negative regulation of transcription"|PF03965|IPR005650| GO:PFM GO:0016566|"GO:specific transcriptional repressor activity"|PF03965|IPR005650| RP:SCP:NREP 1 RP:SCP:REP 4->96|2g9wA1|4e-08|73.3|90/119|a.4.5.39| HM:SCP:REP 1->111|1sd4A_|3e-17|31.2|109/0|a.4.5.39|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 75 OP:NHOMOORG 53 OP:PATTERN -------------------------------------------------------------------- --2-2---------21111-14111111111132531313--121--1-111111-----11---11-122-----------------------------------------------------------------11111---1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 94 STR:RPRED 79.0 SQ:SECSTR HHHHTTTEEEGGGHHHHHHHHHcccccHHHHHHHHHHHHHTTcEEEEccTTccEEccccccccHHHHHHHHHHTTcccHHHHHHHHHHHHHHcc######################### DISOP:02AL 107-119| PSIPRED ccHHHcccccccHHHHHHHHcccccccHHHHHHHHHHHHHccccEEEEccccEEEEEEccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccc //