[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57366.1
DDBJ      :             putative iron transporter ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  904/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:279 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   16->233 1q12A PDBj 8e-25 34.4 %
:RPS:PDB   17->246 3dmdC PDBj 1e-42 11.0 %
:RPS:SCOP  11->246 1b0uA  c.37.1.12 * 3e-39 29.2 %
:HMM:SCOP  17->231 1ii8.1 c.37.1.12 * 3.4e-70 41.0 %
:RPS:PFM   64->177 PF00005 * ABC_tran 3e-13 37.8 %
:HMM:PFM   52->177 PF00005 * ABC_tran 2e-24 34.8 115/118  
:HMM:PFM   41->62 PF05729 * NACHT 0.00021 36.4 22/166  
:BLT:SWISS 13->267 YUSV_BACSU 5e-78 52.9 %
:PROS 149->163|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57366.1 GT:GENE BAD57366.1 GT:PRODUCT putative iron transporter ATP-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2683849..2684688) GB:FROM 2683849 GB:TO 2684688 GB:DIRECTION - GB:PRODUCT putative iron transporter ATP-binding protein GB:PROTEIN_ID BAD57366.1 LENGTH 279 SQ:AASEQ MTVTTTGAAAHQLGAQDIRLGYGDRVIVDGLSLDIAPGVVTTVIGPNGCGKSTLLRSLGRLLRPSAGQVLLDGKAISSMKTKDVARIVGMLPQTPVAPEGLTVADLVARGRHPHQSWLRQWSADDETEVLAALEQTGIADLADRPLDELSGGQRQRAWISMALAQGTDILLLDEPTTYLDLAHSLEVLDLVDRLHDELGRTVVMVLHDLNLAIRYSDRLVVMHDGRIVAQGSPGDIITAELLREVFTLDASVLEDPVSGRPMIVPIGTRHVRPGAARPA GT:EXON 1|1-279:0| BL:SWS:NREP 1 BL:SWS:REP 13->267|YUSV_BACSU|5e-78|52.9|255/275| PROS 149->163|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 54->63|llrslgrllr| BL:PDB:NREP 1 BL:PDB:REP 16->233|1q12A|8e-25|34.4|209/367| RP:PDB:NREP 1 RP:PDB:REP 17->246|3dmdC|1e-42|11.0|209/318| RP:PFM:NREP 1 RP:PFM:REP 64->177|PF00005|3e-13|37.8|111/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 52->177|PF00005|2e-24|34.8|115/118|ABC_tran| HM:PFM:REP 41->62|PF05729|0.00021|36.4|22/166|NACHT| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 11->246|1b0uA|3e-39|29.2|233/258|c.37.1.12| HM:SCP:REP 17->231|1ii8.1|3.4e-70|41.0|212/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 49895 OP:NHOMOORG 1169 OP:PATTERN VVNCQNKMXXWUXUaSpKQRLSPX*SWopalUIADDGFIHGGDWZPViOT**iAVdSUZPVLLHZ1B8 VbpS*hghttwaeVbWYPO-OpBBW*PPPPPOzvux****V*g****jwxqX***TYoEF***o*v****ibaaa*caZU*inB9DABQPNI5NFIG--DDQJHLaITQM8988889DDCBBBBGVQJSYOLURTSlvw**KKJ*cuekscalceUWPLOMSIbean***VGSGOHFFUGOGFnZgNMmdBZdu********z***********w***fly**irrtspqq**TcddcebXcccccccWYZYSvebZ**YOVaaurRS**bWPZlgeegonqttnyuwwnpmnlknpllnZYZYYZabaaZXY*qmgffqorol*v*********c*hm*yyVggb*ljlj*emVM**seXbghQYfbliOZbgMfYXXNMPMLNdW***bTq****************-tv*pk*r***WA**************IJN**********UTUUUUUUvciKUog*656465555555778977995777874A4FGFFFI************************m********AJ**q*k*qv******aplMYLUlVIIIIIIIRNPdrjW**TeZylZmuddrIdZZWWWfWYXXWXw*Z*FJMRDHGHIGEA9BBBBBBBFQCCJQPruuNtTZHRJtSUYZUPTaVTTVUXZbXba6-ELdQP11----*u**W**********zz-*************z*zzzx*****diiqpooqrrrrrpprpop*tosvvuxT1************43IIBDABCMNNMRK*r*aZZYXWHORMLROSdNPRPPHOJRXrb***z****y****m***DDDBCEDCDMeom*qqrrq*****RTOMONMMONCBAB44OTQQIJGH57787888*BVCA9BC-D9ECJE9IGHBFMCDDAAAZftRTp*oknDdN 2355khG-YM6AUdTHDKFHPSNZOXSEEBCACPLLBIFHDGHBDCHFKPSQdUHHMDDEDEF7A4871695A976A25988968957-FM8DFFBDAADBBDLJD4TlcoWgUkeUKIHELXNxv9wC**s3sVxKJKCkFLnWBPIFEdEA*GbUPsMj*NrOV9yXg*fYfNDMGD*CFDEHzkm*F**GH*x**R ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11, 270-279| PSIPRED cccccccccccEEEEEEEEEEEccEEEEEccEEEEcccEEEEEEccccccHHHHHHHHHHcccccccEEEEccEEcccccHHHHHHHcccccccccccccccHHHHHHccccccHHcccccHHHHHHHHHHHHHHcccHHHHcccHHHcccHHHHHHHHHHHHHccccEEEEEccHHHccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHHccEEEEEccHHHHHccHHHHHHcccEEEEEEcccccEEEEEEcccccccccccccc //