[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57375.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.222.1
:192 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  13->104 1j8bA_ d.222.1.1 * 9e-06 17.4 %
:HMM:PFM   19->103 PF02575 * DUF149 3.1e-08 18.8 85/93  
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57375.1 GT:GENE BAD57375.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2691841..2692419 GB:FROM 2691841 GB:TO 2692419 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57375.1 LENGTH 192 SQ:AASEQ MLGNDANQAADELARWAENLERTAQRYQDLQGRMRAISVTERSADGRIAVTVDADGVTTGIELAPGTRGMDPAAVAAELMACTHRAQARLRRQVGELVHDLVGQDGAGQAIVAQYAERFPDPVPAAPQADPAAHADPAVHVDPPGPADPTPPAAYPPPPTTPGTRKPDRDRTVAPAEPDADDLYYRRRSWLE GT:EXON 1|1-192:0| COIL:NAA 28 COIL:NSEG 1 COIL:REGION 4->31| SEG 120->172|pdpvpaapqadpaahadpavhvdppgpadptppaayppppttpgtrkpdrdrt| HM:PFM:NREP 1 HM:PFM:REP 19->103|PF02575|3.1e-08|18.8|85/93|DUF149| HM:SCP:REP 13->104|1j8bA_|9e-06|17.4|92/92|d.222.1.1|1/1|YbaB-like| OP:NHOMO 7 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1---------------------------222-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 148-177| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccHHHHHHHHccc //