[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57376.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:111 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->101 PF10824 * DUF2580 3.7e-05 22.9 96/100  
:BLT:SWISS 12->107 TRUB_ROSDO 2e-04 37.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57376.1 GT:GENE BAD57376.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2692508..2692843 GB:FROM 2692508 GB:TO 2692843 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57376.1 LENGTH 111 SQ:AASEQ MTSAEGVNIEVGVLRAHAATVTETIEGVPKAREAADYLGHVDDGYGLLVGPYARSILNPLHDRISERLRVLVEETGAIPPKLCIAADQFQALEEERAKQLAQQGEQIDRQG GT:EXON 1|1-111:0| BL:SWS:NREP 1 BL:SWS:REP 12->107|TRUB_ROSDO|2e-04|37.2|86/100| HM:PFM:NREP 1 HM:PFM:REP 5->101|PF10824|3.7e-05|22.9|96/100|DUF2580| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 94-111| PSIPRED ccccccccEEHHHHHHHHHHHHHHHHccccHHHHHHHHccccccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //