[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57377.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.3
:331 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   149->311 3c2pB PDBj 9e-04 5.7 %
:HMM:SCOP  161->259 1wa8A1 a.25.3.1 * 4.9e-05 16.2 %
:HMM:PFM   166->224 PF06013 * WXG100 2.9e-05 18.6 59/86  
:HMM:PFM   212->275 PF04513 * Baculo_PEP_C 0.0002 20.3 64/140  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57377.1 GT:GENE BAD57377.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2692847..2693842 GB:FROM 2692847 GB:TO 2693842 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57377.1 LENGTH 331 SQ:AASEQ MSYENQVGKFLNEEAVLPGFPSTFDDPAAPEGNDLIEDKADFRNEYYQEDVPFLTKVGVPKGQVGESDPDAQILKGTVVGDTFEGLHNAWAALQGQDSGRNLYGAALKAWGVAADAVEIADMAKNYLRGIPLAKFDPFNYLGGQLMGWMLEHVEPMRKSLDSLAGNPDMVKAYSSSWAKISQELAGVAADWQRDCATRTAGWVGATADAYRAKVDELTADLITQAGLADVLSTVNQKMADVVDGVRGIITEILNSLAGVLVEIAAILIASAGTASPGLIARAVFEISTATMSVSRMLTQLATVLFDIAALADDVTKMLVGVVEVQAAAAQA GT:EXON 1|1-331:0| SEG 325->330|qaaaaq| RP:PDB:NREP 1 RP:PDB:REP 149->311|3c2pB|9e-04|5.7|157/1093| HM:PFM:NREP 2 HM:PFM:REP 166->224|PF06013|2.9e-05|18.6|59/86|WXG100| HM:PFM:REP 212->275|PF04513|0.0002|20.3|64/140|Baculo_PEP_C| HM:SCP:REP 161->259|1wa8A1|4.9e-05|16.2|99/0|a.25.3.1|1/1|EsxAB dimer-like| OP:NHOMO 18 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1--------2------------------735-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 47.4 SQ:SECSTR ####################################################################################################################################################cEEcccccTTTHHHHHHHHHTHHHHHHHHHHcTTcccccEEcccEEEEETTcHHHHHHHHHHHHHHHHHHHHHHHHHHHccGGGccHHHHHHHHHHHccHHHHTTccHHHHHHHHHHH######HHHHHHHHHHHHHHHHHHTTccEEEccEEcccccEEccc#################### DISOP:02AL 1-6, 330-331| PSIPRED cccHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHccccHHHHccccccccccccccHHHHHHHHccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //