[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57378.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.23.10
:283 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   41->282 3bzwB PDBj 9e-11 12.3 %
:RPS:SCOP  41->282 3bzwA1  c.23.10.9 * 2e-11 10.8 %
:HMM:SCOP  37->285 1esdA_ c.23.10.1 * 2.5e-57 36.7 %
:HMM:PFM   115->222 PF00657 * Lipase_GDSL 7.1e-05 19.1 94/235  
:BLT:SWISS 38->268 LIP_STRRM 2e-12 28.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57378.1 GT:GENE BAD57378.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2693862..2694713) GB:FROM 2693862 GB:TO 2694713 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57378.1 LENGTH 283 SQ:AASEQ MPLGHRLAAAVAGLLALPGVLLPGATAAPTDGGAEYVAAEYVALGDSGAATTGVRDVDLGAPLLCARSTGNTPKLVAAELGLRLDDRTCSSAKIDHLSTSQGPGIAPQFDALGPATRLVTVHIGANDTGMTSYVVGCHLAGLGMGACTTDGWDAAIDGIADEYSAALERISQLAPKARVIVDGWPTYVRPGGCPELVGLRPEDAVLVQRAFDRLNAVVARAAAEHGADYVDARGPSEGRDMCAPAGVRWFDPVLATETLLPYHPTPQGMRGVADLIVAAVRAR GT:EXON 1|1-283:0| BL:SWS:NREP 1 BL:SWS:REP 38->268|LIP_STRRM|2e-12|28.7|216/100| SEG 7->34|laaavagllalpgvllpgataaptdgga| SEG 150->161|dgwdaaidgiad| SEG 216->223|avvaraaa| RP:PDB:NREP 1 RP:PDB:REP 41->282|3bzwB|9e-11|12.3|219/239| HM:PFM:NREP 1 HM:PFM:REP 115->222|PF00657|7.1e-05|19.1|94/235|Lipase_GDSL| RP:SCP:NREP 1 RP:SCP:REP 41->282|3bzwA1|2e-11|10.8|222/248|c.23.10.9| HM:SCP:REP 37->285|1esdA_|2.5e-57|36.7|248/0|c.23.10.1|1/1|SGNH hydrolase| OP:NHOMO 33 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- ----3--1----2-2---------1--------111123---11------------------1-232121------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 237 STR:RPRED 83.7 SQ:SECSTR ########################################EEEEEcTTTcTTTTGGcc######cccGcccHHHHHHHHHccEEEEcccTTcccccccGGGHHHHHHHHHHHHTTTccEEEEEcHHHHHTTccccccEEEEEEcccccEEEEEEEEEccTTcHHHHHHHHHHHcTTcEEEEEcccccccEEccTTcEEccTTcccTTcccHHHHHHHHHHHHHHHTccEEcHHHHcccTcTccTcGGGGGGEEETTTEEEEEEEcHHHHHHHHHHHHGGGccH DISOP:02AL 283-284| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEccHHHccccccccccccccccccccccHHHHHHHHccccEEEEEEcccccccHHcccccccHHHHHcccccccEEEEEEccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEccHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEcHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcc //