[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57385.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:244 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57385.1 GT:GENE BAD57385.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2701365..2702099) GB:FROM 2701365 GB:TO 2702099 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57385.1 LENGTH 244 SQ:AASEQ MDTTDDRRRVSPGEWLARMIAVVLLVPVRMLWEGARLCGRAVGAACRYLLDRLIAPVGRVIWYWVVRPLWLFAKDAVWGWALHHVLWGMVLTPLGAFLLDRLLRPLRRAVEEWVWRRVLRPGLVLLWRWVLRPIGYAVAVVAGRLWRWCVEWPLRVLWRWVLRPLWIAVAAVAWFGWRAATAIVDVLVVRPCRLLYRVIVAPVLRWVAEMWRFAVVRPVRFVHRRVVAPMNRVAAEVLAAVFRR GT:EXON 1|1-244:0| TM:NTM 5 TM:REGION 12->34| TM:REGION 53->75| TM:REGION 121->143| TM:REGION 152->174| TM:REGION 185->207| SEG 98->120|lldrllrplrraveewvwrrvlr| SEG 152->166|wplrvlwrwvlrplw| SEG 212->229|rfavvrpvrfvhrrvvap| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //