[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57390.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
e.3.1
:299 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   65->274 3e2lB PDBj 2e-17 18.8 %
:RPS:SCOP  62->296 1e25A  e.3.1.1 * 4e-13 15.4 %
:HMM:SCOP  62->295 1m40A_ e.3.1.1 * 3.2e-19 24.3 %
:BLT:SWISS 61->271 LPPW_MYCTU 6e-13 30.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57390.1 GT:GENE BAD57390.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2706145..2707044) GB:FROM 2706145 GB:TO 2707044 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57390.1 LENGTH 299 SQ:AASEQ MSSLVRYPKAATGAVPRVAATASVLAAAAILMPGAPTPLPGVTAPAAHAAPAGCFAGFDCDMSSRIRAADDYLAGRPGVTGYVLRDRVSGAVYANEHAEDSVWTASTIKLAIAADLLNRARVGAIVLTPEDRGLIESMLATSNDAATDLLWNKYAGPDRMAYNNAFRANGMVSLVPQPTSTALFPDWSFQKCTAADLDRMMNHVLDVMHPDDRAYLLDRMRAVDSNQHWGVWGAGESMRPGLKNGWSEEQGGWVVNSVGFAGPGERYTLAIMTSMGGEGGYTEGADTDTQLAKLLLAGR GT:EXON 1|1-299:0| BL:SWS:NREP 1 BL:SWS:REP 61->271|LPPW_MYCTU|6e-13|30.0|203/314| SEG 19->29|aatasvlaaaa| SEG 44->58|apaahaapagcfagf| RP:PDB:NREP 1 RP:PDB:REP 65->274|3e2lB|2e-17|18.8|202/258| RP:SCP:NREP 1 RP:SCP:REP 62->296|1e25A|4e-13|15.4|228/278|e.3.1.1| HM:SCP:REP 62->295|1m40A_|3.2e-19|24.3|230/0|e.3.1.1|1/1|beta-lactamase/transpeptidase-like| OP:NHOMO 29 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- --------------1--11-13---111111-1--111---1---------------------1--222-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----11-------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 239 STR:RPRED 79.9 SQ:SECSTR ############################################################ccHHHHHHHHHHHTcEEEEEEEEEEETTTccEEEEEcTTccEEcGGHHHHHHHHHHHHTcccccEcccGGGHHHHHHHHHcccHHHHHHHHHHHTHHHHHHHHHHHHHTTccccccTTGGGcccTTccTTEEcHHHHHHHHHHHHccccHHHHHHHHHHHHTccccTTTGGGGccTTcEEEEEEEEcccTTEEcEEEEEEEEccccEEEEEEEEccccTTccccHHHHHHHHHHHHTTc DISOP:02AL 1-8, 30-56| PSIPRED cccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccEEEEEEEEccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHHccccEEcccccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccccccccccccccccccccccccEEEEEEEEEcccccEEEEEEEccccccccHHHHHHHHHHHHHHHccc //