Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57391.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:76 amino acids
:HMM:PFM   29->75 PF06169 * DUF982 0.0001 29.8 47/76  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57391.1 GT:GENE BAD57391.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2707144..2707374) GB:FROM 2707144 GB:TO 2707374 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57391.1 LENGTH 76 SQ:AASEQ MSKGWFAFMGSMVIPLVPRNGFTVRRVGDRWELVNSRHYGRDVVLHTWPRERHSEAFEHCYRLNGRTVEELRAAFH GT:EXON 1|1-76:0| HM:PFM:NREP 1 HM:PFM:REP 29->75|PF06169|0.0001|29.8|47/76|DUF982| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccHHHHHHcHHEEEEccccEEEEEcccHHHHHcccccccEEEEEccccHHHHHHHHHHHHcccccHHHHHHHcc //