[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57395.1
DDBJ      :             putative amidohydrolase
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  60/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.9
:295 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   145->260 3irsA PDBj 5e-09 33.0 %
:RPS:PDB   23->294 3cjpA PDBj 1e-23 15.1 %
:RPS:SCOP  24->292 2f6kA1  c.1.9.15 * 1e-21 16.0 %
:HMM:SCOP  22->294 2f6kA1 c.1.9.15 * 5.6e-53 32.3 %
:RPS:PFM   93->293 PF04909 * Amidohydro_2 3e-18 39.4 %
:HMM:PFM   24->294 PF04909 * Amidohydro_2 8.3e-43 28.9 253/270  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57395.1 GT:GENE BAD57395.1 GT:PRODUCT putative amidohydrolase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2716156..2717043) GB:FROM 2716156 GB:TO 2717043 GB:DIRECTION - GB:PRODUCT putative amidohydrolase GB:PROTEIN_ID BAD57395.1 LENGTH 295 SQ:AASEQ MTDHTDDTAYLAGFRARLGLPGIVDVHTHFMPEPVMRKVWAYFDAVGPLVGREWPITYRDEEQVRLKTLRDFGVRAFTSLVYPHKPEMAAWLNGWTAEFAARTPDCLHTATFYPEPSAPDYVAAALADGARVFKVHIQVGDFPPNDPLLTPVWGLVAEAGTPVVIHCGSGPAPGRFTGPEPVADILTRFPGLRLIVAHMGTPEYSEFLDLAERFPNVCLDTTMVWTDFSESDAPYPVHEHGRLRDLADRILFGSDFPNIPYPYAHAVQALERLELGEDWLRRVCWENGARMFGLT GT:EXON 1|1-295:0| BL:PDB:NREP 1 BL:PDB:REP 145->260|3irsA|5e-09|33.0|106/281| RP:PDB:NREP 1 RP:PDB:REP 23->294|3cjpA|1e-23|15.1|258/262| RP:PFM:NREP 1 RP:PFM:REP 93->293|PF04909|3e-18|39.4|198/259|Amidohydro_2| HM:PFM:NREP 1 HM:PFM:REP 24->294|PF04909|8.3e-43|28.9|253/270|Amidohydro_2| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF04909|IPR006992| GO:PFM GO:0008152|"GO:metabolic process"|PF04909|IPR006992| RP:SCP:NREP 1 RP:SCP:REP 24->292|2f6kA1|1e-21|16.0|269/306|c.1.9.15| HM:SCP:REP 22->294|2f6kA1|5.6e-53|32.3|260/0|c.1.9.15|1/1|Metallo-dependent hydrolases| OP:NHOMO 70 OP:NHOMOORG 64 OP:PATTERN -------1-----------------------1---------------------11------------- ----2---111---1------1---1------21111122---1--------1-1-----111--11111------------2---------------------1----------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1---------1----------11---1----1-------11------------------1-----------------1--------------------------1111--------------------------------------------------------------------------1111-1-----------------1--12------------------------111-1----------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--1-------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 282 STR:RPRED 95.6 SQ:SECSTR #############cccEGGccccEEEEEEccccHHHHHHHHHHHTccEEEEEcccccGGGcccHHHHHHHHHHHHHHHTTccTTcHHHHHHHHHHHHHHHHHcTTTEEEEEcccTTccHHHHHHHHHHHTTTTTcEEEEcccTTcGGGGHHHHHHHHHTcccEEEccccHHTTccHHHHHHHHHHHHHcTTccEEEGGGGGGGHHHHHHHHHHcTTEEEEcTTccccEcTTcccHHHHHHHHHHcTGTTEEccccTTcTcccHHHHHHHHHHHcccHHHHHHHHTHHHHHHHTcc DISOP:02AL 1-4| PSIPRED ccccHHHHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccEEEEcccccccccccHHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHccccEEEEHHHccccccccHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHccc //