[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57400.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->88 PF10861 * DUF2784 2e-12 45.2 %
:HMM:PFM   3->112 PF10861 * DUF2784 1.5e-39 42.2 109/112  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57400.1 GT:GENE BAD57400.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2722117..2722491) GB:FROM 2722117 GB:TO 2722491 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57400.1 LENGTH 124 SQ:AASEQ MGYRLLADLTALTHFAFVGYVALGGFLAWSRPWAFWPHLAAVGWGFGTVLIGYDCPLTHVENWARRRAGDAELPATGFIDHYLTGVIYPEDAVDLVRLLVAVVVVASWAGALVTIRRRGAPVGP GT:EXON 1|1-124:0| TM:NTM 3 TM:REGION 5->27| TM:REGION 34->56| TM:REGION 93->115| SEG 92->113|avdlvrllvavvvvaswagalv| RP:PFM:NREP 1 RP:PFM:REP 4->88|PF10861|2e-12|45.2|84/114|DUF2784| HM:PFM:NREP 1 HM:PFM:REP 3->112|PF10861|1.5e-39|42.2|109/112|DUF2784| OP:NHOMO 28 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- -----------------11-1----111111-----1111--1---------------------11----2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------------1-1----1----------------1--------1-----------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 121-124| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHEEEEEccccccc //