[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57408.1
DDBJ      :             putative cold shock protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  79/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->65 1g6pA PDBj 1e-10 45.8 %
:RPS:PDB   6->65 3camA PDBj 7e-15 40.0 %
:RPS:SCOP  6->66 1wfqA  b.40.4.5 * 9e-13 23.7 %
:HMM:SCOP  3->69 1h95A_ b.40.4.5 * 7.6e-16 38.8 %
:RPS:PFM   11->66 PF00313 * CSD 6e-10 50.0 %
:HMM:PFM   6->67 PF00313 * CSD 9e-20 45.2 62/67  
:BLT:SWISS 6->66 CSPF_STRCO 1e-11 44.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57408.1 GT:GENE BAD57408.1 GT:PRODUCT putative cold shock protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2729816..2730208) GB:FROM 2729816 GB:TO 2730208 GB:DIRECTION - GB:PRODUCT putative cold shock protein GB:PROTEIN_ID BAD57408.1 LENGTH 130 SQ:AASEQ MLVSIGKLVSFDSSRGFGFIRPEDGGPDVFVHVNDIGLDEDELRQGRVFEFDVTEGDRGPKAINLSAVGGGGPAAAPRARKDRGGQLSADEHRRLITELLLDASPALTAGEILTIRERLTAFADERGWLD GT:EXON 1|1-130:0| BL:SWS:NREP 1 BL:SWS:REP 6->66|CSPF_STRCO|1e-11|44.3|61/67| SEG 67->85|avggggpaaaprarkdrgg| BL:PDB:NREP 1 BL:PDB:REP 6->65|1g6pA|1e-10|45.8|59/66| RP:PDB:NREP 1 RP:PDB:REP 6->65|3camA|7e-15|40.0|60/65| RP:PFM:NREP 1 RP:PFM:REP 11->66|PF00313|6e-10|50.0|56/67|CSD| HM:PFM:NREP 1 HM:PFM:REP 6->67|PF00313|9e-20|45.2|62/67|CSD| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF00313|IPR002059| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00313|IPR002059| RP:SCP:NREP 1 RP:SCP:REP 6->66|1wfqA|9e-13|23.7|59/89|b.40.4.5| HM:SCP:REP 3->69|1h95A_|7.6e-16|38.8|67/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 113 OP:NHOMOORG 82 OP:PATTERN -------------------------11----1------------------------------------ ----1-------------------1------1----11---111-1--------------12----1223-------------------------------------111--------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1-1-----111222--1--1----------------------------------2211-1-111111111111112-------1-23233322323311----------------111---1-------------------------------------111111111------------------------------1--------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 62 STR:RPRED 47.7 SQ:SECSTR ####EEEEEEEETTTTEEEEEETTccccEEEEGGGccGGGccccTTccEEEEEEEETTEEEEEEEE################################################################ DISOP:02AL 1-3, 71-90| PSIPRED ccccccEEEEEEccccEEEEEEcccccEEEEEEEHccccccccccccEEEEEEEEcccccEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccHHHHccccccEEEccc //