[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57415.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.45.1
:143 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   6->132 2arzA PDBj 7e-12 16.7 %
:RPS:SCOP  6->139 1rfeA  b.45.1.1 * 2e-11 24.2 %
:HMM:SCOP  1->138 1rfeA_ b.45.1.1 * 8.9e-20 30.1 %
:HMM:PFM   7->87 PF01243 * Pyridox_oxidase 1.2e-10 25.0 80/89  
:HMM:PFM   74->131 PF10937 * DUF2638 0.00076 26.3 57/113  
:BLT:SWISS 71->121 NDHK_SYNR3 5e-04 45.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57415.1 GT:GENE BAD57415.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2738215..2738646 GB:FROM 2738215 GB:TO 2738646 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57415.1 LENGTH 143 SQ:AASEQ MPLSLEERQEFLTRPHSAALSVAAGPGRGPLLVPIWYQYRPGSDLWVLTGADSRKLRHIRDAGRFSIMVQQVEPTIRYVTVEGPVTGIEPMTDAQHREMVERYLPADKVESYLKAAEAYGPQVVVSMRPERWLSADLGSVDDM GT:EXON 1|1-143:0| BL:SWS:NREP 1 BL:SWS:REP 71->121|NDHK_SYNR3|5e-04|45.5|44/100| RP:PDB:NREP 1 RP:PDB:REP 6->132|2arzA|7e-12|16.7|120/238| HM:PFM:NREP 2 HM:PFM:REP 7->87|PF01243|1.2e-10|25.0|80/89|Pyridox_oxidase| HM:PFM:REP 74->131|PF10937|0.00076|26.3|57/113|DUF2638| RP:SCP:NREP 1 RP:SCP:REP 6->139|1rfeA|2e-11|24.2|132/160|b.45.1.1| HM:SCP:REP 1->138|1rfeA_|8.9e-20|30.1|136/0|b.45.1.1|1/1|FMN-binding split barrel| OP:NHOMO 23 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- --------------211----1---1------22221122-------------------------1--11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 98.6 SQ:SECSTR #HHHHHHHHHHHHHccEEEEEEEccccTTEEEEEEEcEEcTTccEEEEEETTcHHHHHHHHccEEEEEEEcTTcccTTcccEEEEEEcEEEEEEEEEEccHHHHHHHHHHHHcGGGTTccTTEEEEEEEEEEEcccccccTT# DISOP:02AL 1-3| PSIPRED ccccHHHHHHHHcccccEEEEEEcccccccEEEEEEEEEEcccEEEEEEcccHHHHHHHHHccEEEEEEEcccccEEEEEEEEEEEEEccccHHHHHHHHHHHccccccHHHHHHHHccccEEEEEEEEEEEEEEEccccccc //