[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57417.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:161 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->82 PF03189 * Otopetrin 0.00025 21.6 74/442  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57417.1 GT:GENE BAD57417.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2739189..2739674) GB:FROM 2739189 GB:TO 2739674 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57417.1 LENGTH 161 SQ:AASEQ METPTGRSRRRDAMSVMSSGQDSQAGLGSVDRIRTWSSMILGTLALVTAAGIVVLFHVSQPEPGRLAATDVLVLVLVGLSTCTFLAAGALVLRGRTPAVVLRAVELLLWLDLMVLGAATIVLLAGGSLAPLTWLAAIGFGFDIARVLRTAVRSGGRSRRPA GT:EXON 1|1-161:0| TM:NTM 4 TM:REGION 37->59| TM:REGION 68->90| TM:REGION 100->122| TM:REGION 130->152| SEG 71->79|vlvlvlvgl| SEG 106->115|lllwldlmvl| HM:PFM:NREP 1 HM:PFM:REP 8->82|PF03189|0.00025|21.6|74/442|Otopetrin| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-27, 152-161| PSIPRED cccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHccccccccc //