[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57422.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  31/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:218 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   44->195 2br5A PDBj 5e-04 17.7 %
:RPS:SCOP  47->210 1h1dA  c.66.1.1 * 7e-08 23.3 %
:HMM:SCOP  25->204 2cl5A1 c.66.1.1 * 2.2e-09 22.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57422.1 GT:GENE BAD57422.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2744438..2745094 GB:FROM 2744438 GB:TO 2745094 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57422.1 LENGTH 218 SQ:AASEQ MTQLSAGSAVSEAELFDISRSVRGFLPEDEGRALHAAAARYCAGGPLVEIGTYCGKSTLLLGAAARACGSTVYTVDHHRGSEEHQPGWEYHDSSLVDPETGCFDTLPEFRRTVLRAGLGDTVVALVGTSTQLSSVWGAPLDFLFIDGGHTEEAAQADYSGWAKFVAVGKALAIHDVFPDPADGGRPPYHIYRRALDSGEFREVSATGSLRVLERTGDS GT:EXON 1|1-218:0| SEG 33->43|alhaaaaryca| RP:PDB:NREP 1 RP:PDB:REP 44->195|2br5A|5e-04|17.7|124/226| RP:SCP:NREP 1 RP:SCP:REP 47->210|1h1dA|7e-08|23.3|133/214|c.66.1.1| HM:SCP:REP 25->204|2cl5A1|2.2e-09|22.6|155/0|c.66.1.1|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 33 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- ---11----------11----1--11------11111-11-111------------------1----1111---------------------------------------------------------------------------2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1-------------------------------------------------------------------------------------------------------------------------------------211-----1------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 124 STR:RPRED 56.9 SQ:SECSTR ###########################################ccEEEEEccTTcHHHHHHHHHHHHTTcEEEEEEcccTTccccGGGcTT####EEEEEccTTcTHHHHT#######################cccccccEEEEEcccTTHHHHH#HHHHHHTccTTcEEEEcccHHHHHHHcHHHHHHHTTTT####################### DISOP:02AL 1-11, 216-218| PSIPRED cccccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHcccccEEEEEHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHcccccccccccccHHHHHHHccHHHHHHHHHcccccEEEEEcccHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHHcccEEEEccccHHHHHHHcccc //