[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57423.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  29/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.102.1
:348 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   11->145 2a73B PDBj 1e-10 8.9 %
:RPS:SCOP  17->308 1lf6A1  a.102.1.5 * 7e-09 14.0 %
:HMM:SCOP  19->336 1ug9A1 a.102.1.5 * 1.6e-45 28.2 %
:HMM:PFM   73->85 PF09282 * Mago-bind 6.4e-05 61.5 13/27  
:HMM:PFM   107->136 PF04685 * DUF608 0.00046 33.3 30/365  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57423.1 GT:GENE BAD57423.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2745113..2746159) GB:FROM 2745113 GB:TO 2746159 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57423.1 LENGTH 348 SQ:AASEQ MPPSELPGVPWALTRSQCHRTGASIAAAQEPTGAIPWFPGGHTDPWDHVESAMALTVTGFRDEAVAAYRWSAETQRPDGSWPRQFRAGVVEDGGAETNFCAYLATGVYHHVLCTGDLNLAAELWPTVRAAVDFVLAAAGPQGQIYWAADEHGGVLAEALVTGCASIHHSLGCAVALAELMNDPRPEWALARHRLGAALRHRPDLFTPKDRYSMDWYYPVLGGALRGPAAVARIDARWDDFVVGNIGIRCVADRPWVTGAETCELVMALDALGDDDRAHRLFAAMQHLRENDGSYWTGLVFADGKRWPEERTTWTAAAVVLAADALSRTTPANGLFRSTALPVPAPVGV GT:EXON 1|1-348:0| SEG 188->201|alarhrlgaalrhr| SEG 315->325|aaavvlaadal| RP:PDB:NREP 1 RP:PDB:REP 11->145|2a73B|1e-10|8.9|135/976| HM:PFM:NREP 2 HM:PFM:REP 73->85|PF09282|6.4e-05|61.5|13/27|Mago-bind| HM:PFM:REP 107->136|PF04685|0.00046|33.3|30/365|DUF608| RP:SCP:NREP 1 RP:SCP:REP 17->308|1lf6A1|7e-09|14.0|279/397|a.102.1.5| HM:SCP:REP 19->336|1ug9A1|1.6e-45|28.2|298/0|a.102.1.5|1/1|Six-hairpin glycosidases| OP:NHOMO 29 OP:NHOMOORG 29 OP:PATTERN -------------------------------------------------------------------- ---11----------11----1--11------11111-11-111------------------1----1111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1-------------------------------------------------------------------------------------------------------------------------------------111------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 310 STR:RPRED 89.1 SQ:SECSTR ####ccccEEHHTTTcccHHHHHHHHHTccTTTcccccccHHHHHHHHHHHHHHHHHTTcTTTHHHHHHHHHTccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEEcTTccccEEEEEEccccccEEEEEEcccccEGcETTEEEEEEEccHHHHHHHHHHHHHHHHHHHHTTcTTccccccTTccGGGGcccTTcccccTTccccHHHHHHHHccccccTTcccccTTcccTTccTTccccTTccTTccccccGGGTTTTTcccccTTcHHHHHHHHHHHHHHHEETTcccccETTEEccccHHH################################## DISOP:02AL 1-4| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHHccccEEEEEEcccccEEHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccccccEEccccccccccccHHHHHHHHHHHHHcccccHHHHcccccccccccccc //