[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57427.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.152.1
:127 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   18->120 2af7A PDBj 2e-08 19.6 %
:RPS:SCOP  19->98 2af7A1  a.152.1.2 * 2e-06 20.3 %
:HMM:SCOP  15->107 2af7A1 a.152.1.2 * 1.7e-10 30.4 %
:HMM:PFM   39->103 PF02627 * CMD 2.1e-09 25.4 63/85  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57427.1 GT:GENE BAD57427.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2749037..2749420) GB:FROM 2749037 GB:TO 2749420 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57427.1 LENGTH 127 SQ:AASEQ MTAPHPPTGAENPGPTVRERGLAKMAEVYGFDFADGTDELFALTADHLFAGIWSRPGLSVRDRRLLLLGALTAGGLPDVASIQVSAALHNGECTGEQLHAIARFLGTQLDPAQGEALDEVVTAALGA GT:EXON 1|1-127:0| SEG 65->76|llllgaltaggl| RP:PDB:NREP 1 RP:PDB:REP 18->120|2af7A|2e-08|19.6|102/114| HM:PFM:NREP 1 HM:PFM:REP 39->103|PF02627|2.1e-09|25.4|63/85|CMD| RP:SCP:NREP 1 RP:SCP:REP 19->98|2af7A1|2e-06|20.3|79/119|a.152.1.2| HM:SCP:REP 15->107|2af7A1|1.7e-10|30.4|92/0|a.152.1.2|1/1|AhpD-like| OP:NHOMO 23 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- --------------11111-11--1111111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 105 STR:RPRED 82.7 SQ:SECSTR #################HHHHHHHHHcHHHHHHHHHcHHHHHHHHHTccccccTcccccHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHTT#ccHHHHHHHHHHTcHHHHHHHHHHHHHHccc#### DISOP:02AL 1-19| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcc //