[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57431.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:183 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   6->141 2a15A PDBj 6e-10 11.1 %
:RPS:SCOP  25->136 3d9rA1  d.17.4.27 * 3e-10 15.9 %
:HMM:SCOP  1->145 1tuhA_ d.17.4.11 * 1.8e-14 29.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57431.1 GT:GENE BAD57431.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2752011..2752562 GB:FROM 2752011 GB:TO 2752562 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57431.1 LENGTH 183 SQ:AASEQ MTGYEREELDEMVRRWVAENQRCEEKGDWKPLAELYTEDATYGWNYGPTQEFMAVGRAEIRELALGQEMLGLEGWTYPYQEFVVDDRSGSVIGLWKQVADATRPDGSHYTVNGIGGSWFRYGGNFQWSWQRDFFDFGNVSALFLEMITADALSPGMQQRIQRSTSGTRLPGWYKIGESPVPLW GT:EXON 1|1-183:0| RP:PDB:NREP 1 RP:PDB:REP 6->141|2a15A|6e-10|11.1|126/133| RP:SCP:NREP 1 RP:SCP:REP 25->136|3d9rA1|3e-10|15.9|107/132|d.17.4.27| HM:SCP:REP 1->145|1tuhA_|1.8e-14|29.7|128/131|d.17.4.11|1/1|NTF2-like| OP:NHOMO 26 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- --------------11111-11--1111111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 158 STR:RPRED 86.3 SQ:SECSTR ccccHccHHHHHHHHHHHccHHHHHTTcHHHHHHTEEEEEEEEccccccTTcTEEcHHHHHHHHHHHTTTTTcEEEEEEEEEcccTTEEEEEEEEEEEEEEEETTTEEEEEEEEEEEEEEEcTTccEEEEEEEccGGGcEEHHHTHH##HTTcGGGcccc####################### DISOP:02AL 1-3| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHcccccEEEEccccccccEEEcHHHHHHHHHccccccccccccccEEEEEEccccEEEEEEEcccccccccccEEEEEccccEEEEEccccEEEHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccEEcccccccccc //