[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57439.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
d.144.1
:354 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   207->269 3dxpA PDBj 9e-05 42.6 %
:RPS:PDB   16->289 2ckpA PDBj 3e-10 14.9 %
:RPS:SCOP  18->352 1zylA1  d.144.1.6 * 4e-11 13.5 %
:HMM:SCOP  22->290 1nd4A_ d.144.1.6 * 1.1e-19 25.6 %
:RPS:PFM   219->314 PF07914 * DUF1679 1e-11 34.4 %
:HMM:PFM   37->286 PF01636 * APH 2.3e-22 27.8 216/238  
:BLT:SWISS 212->288 ACD10_MOUSE 4e-08 40.3 %
:PROS 222->234|PS00109|PROTEIN_KINASE_TYR

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57439.1 GT:GENE BAD57439.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2761723..2762787 GB:FROM 2761723 GB:TO 2762787 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57439.1 LENGTH 354 SQ:AASEQ MSADATAADLEPACTAAELTPEWLGRALGRPVRAARVEPVGTGQIGAVYRVHLDGAGVPERVLAKLPAADPGTRAMLAGPYRQEVAFYTRLAATVAVRVPRCHHAVSRGDGAEFTLLLEDLAPATPGDQIAGCGYPEAAAAVRNLAGLHAPRWCDPALLDEPGLSLNGPGEAAMLADLYGPALDTFLARLGDRLDPADAGTLRACAAGSADWLVARPERFALVHGDYRLDNLLFDTRGGGTVTAVDWQTLGLGLPARDLAYFVGTALDPADRARHEDALVEQYWRALCELGVTGYTLGQCRRDYVFAMPQGPLVAVFGAAYGTPSERGDAMFAAMVRRSCAAIRELGSLAAAPG GT:EXON 1|1-354:0| BL:SWS:NREP 1 BL:SWS:REP 212->288|ACD10_MOUSE|4e-08|40.3|77/1069| PROS 222->234|PS00109|PROTEIN_KINASE_TYR|PDOC00100| BL:PDB:NREP 1 BL:PDB:REP 207->269|3dxpA|9e-05|42.6|61/312| RP:PDB:NREP 1 RP:PDB:REP 16->289|2ckpA|3e-10|14.9|235/316| RP:PFM:NREP 1 RP:PFM:REP 219->314|PF07914|1e-11|34.4|96/409|DUF1679| HM:PFM:NREP 1 HM:PFM:REP 37->286|PF01636|2.3e-22|27.8|216/238|APH| RP:SCP:NREP 1 RP:SCP:REP 18->352|1zylA1|4e-11|13.5|304/325|d.144.1.6| HM:SCP:REP 22->290|1nd4A_|1.1e-19|25.6|242/255|d.144.1.6|1/1|Protein kinase-like (PK-like)| OP:NHOMO 59 OP:NHOMOORG 32 OP:PATTERN -------------------------------------------------------------------- ---------------43----3--34-----154441--2---1---------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------1----------------2---------------------------------------------------------11-1-----1----------------------------------1---------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------1------------------------------------------11111---1------------------------------------------------------11------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 284 STR:RPRED 80.2 SQ:SECSTR ###############THHHHHHHccTHHHHcGGGccccEEEcccccEEEEEEccc####cEEEEEEccccccccEEEcccEEHHHHHHHHHHHTTccccEEEEEEcTcTTEEETTEEEEEccccccccGGGTTcHHHHHHHHHHHHHHHHccccccccTTHHHHHHHHHHHHHHHHHHHccHHHHHHHHHTTcHcHHHHHHHHHHHHHHHHHHHTccccEEEEcccccGGGcccccccTHHHHHHHHHHTTcEEcccccTTccEEcGGGcccHHHHHHHHHHHHHHHcGHHHHHHHHHHHHTT################################################### DISOP:02AL 1-3| PSIPRED cccccccHHccccccHHHccHHHHHHHHccccccEEEEEEccccEEEEEEEEEEccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccccEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccEEEccccccEEEEEEcHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccc //