[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57442.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:214 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->210 1t56A PDBj 2e-11 27.2 %
:RPS:PDB   18->186 3bniA PDBj 2e-09 12.5 %
:RPS:SCOP  18->86 1ui5A1  a.4.1.9 * 2e-07 20.6 %
:RPS:SCOP  117->186 2hyjA2  a.121.1.1 * 3e-04 18.6 %
:HMM:SCOP  17->88 1ui5A1 a.4.1.9 * 3.6e-10 35.2 %
:HMM:SCOP  92->210 1t56A2 a.121.1.1 * 4.8e-19 28.6 %
:HMM:PFM   40->72 PF00440 * TetR_N 7.3e-11 39.4 33/47  
:BLT:SWISS 17->83 YXBF_BACSU 5e-05 31.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57442.1 GT:GENE BAD57442.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2766139..2766783 GB:FROM 2766139 GB:TO 2766783 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57442.1 LENGTH 214 SQ:AASEQ MPSLTRVPRSARKPDDERRAEFERRVLAAVEDLLADGTPYTEIAVQKIAAASGAARSTFYRYFPDKSELLVRMAELATTDLFEAAENWWRAEHTEEPAGVVAAIAAMIAGFREHRYLLLALSEVAAYDRAVGRYWRGRVAAFVAIVRERLDAEKAAGRIDPAVDSAATALVLTAMVERAIATAFASNSAVGDDALAAALGRAIWLIVYGDAPGR GT:EXON 1|1-214:0| BL:SWS:NREP 1 BL:SWS:REP 17->83|YXBF_BACSU|5e-05|31.3|67/380| SEG 98->110|agvvaaiaamiag| SEG 189->202|avgddalaaalgra| BL:PDB:NREP 1 BL:PDB:REP 23->210|1t56A|2e-11|27.2|184/193| RP:PDB:NREP 1 RP:PDB:REP 18->186|3bniA|2e-09|12.5|168/174| HM:PFM:NREP 1 HM:PFM:REP 40->72|PF00440|7.3e-11|39.4|33/47|TetR_N| RP:SCP:NREP 2 RP:SCP:REP 18->86|1ui5A1|2e-07|20.6|68/71|a.4.1.9| RP:SCP:REP 117->186|2hyjA2|3e-04|18.6|70/118|a.121.1.1| HM:SCP:REP 17->88|1ui5A1|3.6e-10|35.2|71/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 92->210|1t56A2|4.8e-19|28.6|119/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 24 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- --------------11111-11--22111112----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1-1----------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 200 STR:RPRED 93.5 SQ:SECSTR ##########HHHHHcccHHHHHHHHHHHHHHHHHHHccTTTccHHHHHHHHTccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcTTTTTcccccHHHHHHHHHHHHHTccccHHHHHHHHHHHHHHHHHHHHHHHHcTTccHHHHHHHHHHHHHHHHHcHccccHHHHHHHHHHHHHHHHcc#### DISOP:02AL 1-23, 212-214| PSIPRED cccccccccccccccccHHHHHHHHHHHHHHHHHHHccccHHccHHHHHHHHccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccc //