[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57444.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
:155 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57444.1 GT:GENE BAD57444.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2767467..2767934 GB:FROM 2767467 GB:TO 2767934 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57444.1 LENGTH 155 SQ:AASEQ MSEQIDWRQLREQHEGVSPRDLDRLWAQLPTARAEDILGNWRGDAFPTGHPLCRALPASRWYGKHFLALDDAKPLICRAEDGSLFSNVELGQGEATLWNIEFRGEVTATMVYDGRAVFDHFKWLDENTLMGIMNGRPELVLSRGEHFYFLLERDS GT:EXON 1|1-155:0| OP:NHOMO 23 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- --------------111-------11-----1-1111111------------------------1---1-----------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ----------------------1111------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccccHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHcccccccccccHHHHHHHHHcccccccccccccEEEEEccccccccHHHHcccccEEEEEEcccEEEEEEEEccccHHHHHHHHcHHHHHHHHcccccccccccccEEEEEEEcc //