[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57448.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:76 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   15->67 PF04149 * DUF397 2e-09 58.8 %
:HMM:PFM   14->68 PF04149 * DUF397 3.1e-22 51.9 54/56  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57448.1 GT:GENE BAD57448.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2770662..2770892 GB:FROM 2770662 GB:TO 2770892 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57448.1 LENGTH 76 SQ:AASEQ MDMSETIAHRITGAWRKSSFSGPSGGNCVELAEATNGLVAMRNSRDPEGAVIFYTRPEIDAFVRGAKAGEFDDLTN GT:EXON 1|1-76:0| RP:PFM:NREP 1 RP:PFM:REP 15->67|PF04149|2e-09|58.8|51/55|DUF397| HM:PFM:NREP 1 HM:PFM:REP 14->68|PF04149|3.1e-22|51.9|54/56|DUF397| OP:NHOMO 31 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ----3-------------------------------2----222----------------21--2213441---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 20-24, 75-76| PSIPRED ccccccccccccccEEEccccccccccEEEEEcccccEEEEEccccccccEEEEcHHHHHHHHHHHcccccccccc //