[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57450.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:101 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   42->84 PF08657 * DASH_Spc34 0.00032 23.1 39/262  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57450.1 GT:GENE BAD57450.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2772128..2772433) GB:FROM 2772128 GB:TO 2772433 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57450.1 LENGTH 101 SQ:AASEQ MNQPLIGGHVGLAESALAVQPANGRTMSTPSARSGQRTTSYSRETAVAFVIDAVESTGAATRNDFDIDRIVNTAHDLADDWDLNTLQPETFWRIAATFIKQ GT:EXON 1|1-101:0| HM:PFM:NREP 1 HM:PFM:REP 42->84|PF08657|0.00032|23.1|39/262|DASH_Spc34| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 24-40| PSIPRED ccccccccccccccccEEEEcccccEEccccccccccccccccHHHHHHHEEHHHHccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHcc //