[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57451.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  48/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:219 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->157 3e8xA PDBj 1e-09 28.3 %
:RPS:PDB   1->35 2bllA PDBj 4e-04 28.6 %
:RPS:SCOP  3->159 1xq6A  c.2.1.2 * 2e-12 19.9 %
:HMM:SCOP  1->209 2fmuA1 c.2.1.2 * 4.7e-37 35.2 %
:RPS:PFM   3->155 PF05368 * NmrA 2e-08 32.9 %
:HMM:PFM   3->165 PF05368 * NmrA 1.9e-12 25.2 151/233  
:BLT:SWISS 4->159 YGL3_SCHPO 7e-11 29.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57451.1 GT:GENE BAD57451.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2773030..2773689) GB:FROM 2773030 GB:TO 2773689 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57451.1 LENGTH 219 SQ:AASEQ MDVVIAGGHGKIALLLAEQLTANGHRVRSLIRNPEHTGDVAATGAEPVLLDLEQADVTAVAAALAGADAAVFAAGAGPGSGAARKYTVDRDGSVLLAEAAQRAGVRRFVQISAMGTGAPPAPGTDEVWAAYLDAKTQAEDDLRSRDLDWTVLRPGRLVDTVSSGSVTLSTGRVGRDSIARADVAAVIAALLPAANTVHTTLELVAGVTPISEAVAAISN GT:EXON 1|1-219:0| BL:SWS:NREP 1 BL:SWS:REP 4->159|YGL3_SCHPO|7e-11|29.5|156/247| SEG 55->83|advtavaaalagadaavfaagagpgsgaa| SEG 160->194|tvssgsvtlstgrvgrdsiaradvaaviaallpaa| BL:PDB:NREP 1 BL:PDB:REP 3->157|3e8xA|1e-09|28.3|145/209| RP:PDB:NREP 1 RP:PDB:REP 1->35|2bllA|4e-04|28.6|35/330| RP:PFM:NREP 1 RP:PFM:REP 3->155|PF05368|2e-08|32.9|140/234|NmrA| HM:PFM:NREP 1 HM:PFM:REP 3->165|PF05368|1.9e-12|25.2|151/233|NmrA| RP:SCP:NREP 1 RP:SCP:REP 3->159|1xq6A|2e-12|19.9|156/253|c.2.1.2| HM:SCP:REP 1->209|2fmuA1|4.7e-37|35.2|199/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 55 OP:NHOMOORG 55 OP:PATTERN -------------------------------------------------------------------- ----11-----11-111----1--11-----111111111----1111111-1111-1----1-1111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-------------------------------------------------------------------- ----------------1--------------------------------------------------------1---------------1--1--1-1----1------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 148 STR:RPRED 67.6 SQ:SECSTR cEEEEETcccHHHHHHHHHHHHcTTcEEEEEEcccccHHHHHHHHHTTcEEEEcccGGGGTTccEEEEcccccTTccHH####HHHHTTTHHHHHHHHHHHHHTccEEE#EccTTc#ccGGGccGH###HHHHHHHHHHHHHHHcccEEEEEEEccE############################################################## DISOP:02AL 218-220| PSIPRED cEEEEEccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHccccEEEEEcccccHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccccccccccHHHcHHHHHHHHHHHHHHHccccEEEEEcccccccccccEEEEcccccccccEEHHHHHHHHHHHHHcccccccEEEEccccccHHHHHHHHcc //