[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57452.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:166 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   69->162 PF10783 * DUF2599 3e-17 55.1 %
:HMM:PFM   69->162 PF10783 * DUF2599 1.1e-34 52.8 89/93  
:HMM:PFM   6->59 PF10738 * Lpp-LpqN 0.00017 35.2 54/241  
:BLT:SWISS 62->165 Y487_MYCBO 4e-21 43.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57452.1 GT:GENE BAD57452.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2773722..2774222) GB:FROM 2773722 GB:TO 2774222 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57452.1 LENGTH 166 SQ:AASEQ MTLRRPAGRRAAAILAPLALAALLTGCGDDQPAAAPPATATTPRPPTTATPPPVAALPTIDPYADVPLIDRVEWTDTVDGDRLLVVPTRAGRDTTFPGAENRAWAEIVELSPAADSPGMRDQFVCHWHWARLVQPDKPSWNLEPWRPAVGYQETVRASCNPGGPER GT:EXON 1|1-166:0| BL:SWS:NREP 1 BL:SWS:REP 62->165|Y487_MYCBO|4e-21|43.3|104/148| SEG 3->24|lrrpagrraaailaplalaall| SEG 32->59|paaappatattprppttatpppvaalpt| RP:PFM:NREP 1 RP:PFM:REP 69->162|PF10783|3e-17|55.1|89/93|DUF2599| HM:PFM:NREP 2 HM:PFM:REP 69->162|PF10783|1.1e-34|52.8|89/93|DUF2599| HM:PFM:REP 6->59|PF10738|0.00017|35.2|54/241|Lpp-LpqN| OP:NHOMO 24 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- --------------11111-11111111111111111-----------1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 158-159, 162-166| PSIPRED ccccccccccHHHHHHHHHHHHHHHHccccccEEcccccccccccccccccccEEEEccccccccccccccccEEEEccccEEEEEEcccccccccccccHHHHHHHHHcccccccHHHHHHEEEEEEEEEEEcccccccccccccccccHHHHHHHccccccccc //