[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57458.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:140 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57458.1 GT:GENE BAD57458.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2780935..2781357 GB:FROM 2780935 GB:TO 2781357 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57458.1 LENGTH 140 SQ:AASEQ MTGACAPASSRSQSRSSASTEGCPMHVAYVVLTALAAAAAAFAAGVDLVRPEWVRANMRTYGIPDRALYPLAAVKAIGALGLLAGLVVAPVGLAAAIGLVGYFSLAVLTVLRARVFADVGYPLPYLAISVAALGVTLVAS GT:EXON 1|1-140:0| TM:NTM 4 TM:REGION 27->49| TM:REGION 66->88| TM:REGION 91->112| TM:REGION 119->140| SEG 8->19|assrsqsrssas| SEG 27->49|vayvvltalaaaaaafaagvdlv| SEG 71->101|laavkaigalgllaglvvapvglaaaiglvg| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-23| PSIPRED cccccccccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcc //