[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57460.1
DDBJ      :             putative cholesterol oxidase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  84/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:577 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->40,193->306,421->517 3coxA PDBj 4e-09 45.5 %
:RPS:PDB   5->519 1cf3A PDBj 2e-26 13.1 %
:RPS:SCOP  5->275,446->521 1cf3A1  c.3.1.2 * 1e-17 14.8 %
:HMM:SCOP  6->527 1gpeA1 c.3.1.2 * 3.3e-45 30.8 %
:RPS:PFM   1->39 PF01946 * Thi4 4e-05 46.2 %
:RPS:PFM   457->517 PF05199 * GMC_oxred_C 3e-11 47.5 %
:HMM:PFM   461->518 PF05199 * GMC_oxred_C 2.1e-15 44.8 58/145  
:HMM:PFM   9->272 PF01266 * DAO 1.8e-12 23.6 203/358  
:BLT:SWISS 4->37 CRTSO_DAUCA 6e-04 47.1 %
:BLT:SWISS 193->306,421->517 CHOD_BREST 3e-08 44.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57460.1 GT:GENE BAD57460.1 GT:PRODUCT putative cholesterol oxidase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2783070..2784803) GB:FROM 2783070 GB:TO 2784803 GB:DIRECTION - GB:PRODUCT putative cholesterol oxidase GB:PROTEIN_ID BAD57460.1 LENGTH 577 SQ:AASEQ MTQRETDFDVLIVGSGFGGSVTALRLVEKGYRVGVLEAGQRFADHELPKTSWDVRKFLWAPALGCYGIQRIHLLRDVLILGGAGVGGGSLNYANTLYVPPEPFFRDPQWRDITDWREELTPYYEQAQKMLGVVRNPHMTPADEVFKKVADDMGFGDTFVQTPVGVFFGEPGKTVPDPYFGGVGPERTGCVECGDCMVGCKYGAKNTLVKNYLYLAEQAGAQVVPMTTVTAIRPLPDGTWDVETKRTGKLIGKQPKTYTAGHVVLAAGTRGTQQLLFAMRDKGVLPKLSDRLGVLTRTNSESIVGAATKTLQPGQDFTKGVAITSSIHPTPDTHIEPVRYGKGSNFMGLLQTLMVDGGGRIPRWLKFLLLVLRHPLDLLSFLSTKNWSERTIISLVMQHLDNSITTYTKRGLFGRKMTSKQGHGQPNPTWIPVGNQVTRKVAEEIGGIAGGSWGEIFNIPLTAHFLGGAAIGADPEHGVIDPYHRVYGYPTLSVVDGAAVSANLGVNPSLTITAQAERAAAYWPNKGEQDKRPPQGEGYRRIDPVPPVRPVVPAEAPAALVLPISPVRRTEQDTPAAG GT:EXON 1|1-577:0| BL:SWS:NREP 2 BL:SWS:REP 4->37|CRTSO_DAUCA|6e-04|47.1|34/615| BL:SWS:REP 193->306,421->517|CHOD_BREST|3e-08|44.3|199/552| SEG 81->88|ggagvggg| SEG 367->378|lllvlrhpldll| SEG 543->562|pvppvrpvvpaeapaalvlp| BL:PDB:NREP 1 BL:PDB:REP 11->40,193->306,421->517|3coxA|4e-09|45.5|229/500| RP:PDB:NREP 1 RP:PDB:REP 5->519|1cf3A|2e-26|13.1|505/581| RP:PFM:NREP 2 RP:PFM:REP 1->39|PF01946|4e-05|46.2|39/80|Thi4| RP:PFM:REP 457->517|PF05199|3e-11|47.5|61/140|GMC_oxred_C| HM:PFM:NREP 2 HM:PFM:REP 461->518|PF05199|2.1e-15|44.8|58/145|GMC_oxred_C| HM:PFM:REP 9->272|PF01266|1.8e-12|23.6|203/358|DAO| GO:PFM:NREP 2 GO:PFM GO:0009228|"GO:thiamin biosynthetic process"|PF01946|IPR002922| GO:PFM GO:0016614|"GO:oxidoreductase activity, acting on CH-OH group of donors"|PF05199|IPR007867| RP:SCP:NREP 1 RP:SCP:REP 5->275,446->521|1cf3A1|1e-17|14.8|346/385|c.3.1.2| HM:SCP:REP 6->527|1gpeA1|3.3e-45|30.8|312/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 110 OP:NHOMOORG 84 OP:PATTERN -------------------------------------------------------------------- -12-2------1-121111-12112111111211114222-112----------1-----111-3211111-----------------------------------------------------------------------------------------------1--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111--1-1111-1--1--1-----11-------1---------1--------------21----------------------111151-------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------11-11------1------1----------------------------------------------------111233------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 542 STR:RPRED 93.9 SQ:SECSTR cccTTcEEEEEEEcccHHHHHHHHHHTTcTccEEEEEcccccTTccHHHHcGGGTTTTTTcTTcEEccccTTTcccEEcccccTTGGGGTcccccccccHHHHHHHHHTTccTTccHHHHHHHHHHEEEccccHHHHHHTccccGGGccccccEEEcccccccccHHHTTTccccccTTccTTTcccccEEEcccccccTTcccccHHHHHTGGTTcTTEEEEEccEEEEEEEEccccccEEEEEEEEETTEEEEEEEEEEEEEcccTTTHHHHHHHHGGGTccccccccTTccccccEEEEEEEEEcGGGccccHHcHHHHHHHHHHTTccccHHHHHHHHHHHHHHHHTTccEEEEEETEEEEEEEEcccccccEEEEccccGGGccEEEEccTTccHHHHHHHHHHHHHHHHHHTcGGGGGTEEEEEEcGGGccTTccHHHHTHHHHHHHGGGccEEccccccTTccccGGGTccccTTcccTTcccEEEccTTccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEE################################### DISOP:02AL 1-4, 527-537, 569-577| PSIPRED cccccccccEEEEcccHHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHcccccccccccccccccccEEcccccccccHHHHccEEccccHHHHHccccccccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHcccccccccHHHHHHHHHccHHHccccccccccccccccEEEcccccccccccccccHHHHHHHHHccccEEEEccEEEEEEEEcccEEEEEEEEcccccccEEEEEEEcEEEEEccccHHHHHHHHccccccccccccccccccccHHHHHHEEEEEEEccccccccccEEcEEEcccccccccccccccccHHHHcccccccccccccHHHHHHHHHHHcccHHHHHcccccccccHHHHHHHHccccccEEEHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEcccccccccccccccEEccccEEEccccEEEEccHHccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHcccEEEEEcccccccccc //