[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57467.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:99 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 15->86 Y967_CORGL 2e-04 31.9 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57467.1 GT:GENE BAD57467.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2791531..2791830 GB:FROM 2791531 GB:TO 2791830 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57467.1 LENGTH 99 SQ:AASEQ MYPQWCRTGDDRFPAAASVDGAWWVLRRNPFPDHDLWTVFVDGAARYDLNDLPAGWGRPLTVSTMLEAATASAILAVVEPFAVYGSEVGAPCDDPFCCG GT:EXON 1|1-99:0| BL:SWS:NREP 1 BL:SWS:REP 15->86|Y967_CORGL|2e-04|31.9|72/100| TM:NTM 1 TM:REGION 61->83| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ----1--------------------1----------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccccccccccccccccccccEEEEEEccccccccEEEEEEccccccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccc //