[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57468.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:196 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   60->101 PF02698 * DUF218 0.00021 28.6 42/155  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57468.1 GT:GENE BAD57468.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2791827..2792417 GB:FROM 2791827 GB:TO 2792417 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57468.1 LENGTH 196 SQ:AASEQ MTASDPGRWVQCQGGVHEVVVGAVAGDLDADLRDARAADDDVVDGAGPAGTLAGAGRGRVLGWDRDGEVGQMLRDRVTAGVEVAEQHDRPVGVFAGEGGEPVELAVGAAASAQMGGDGDEFVGLYGEHALARVVGEGLGDQWTGGFVEDEHQVFGGFGQFGGRASRRGHAGVAEIRHGPVREGDAQAVEQVAADFL GT:EXON 1|1-196:0| SEG 14->62|ggvhevvvgavagdldadlrdaraadddvvdgagpagtlagagrgrvlg| SEG 154->168|fggfgqfggrasrrg| HM:PFM:NREP 1 HM:PFM:REP 60->101|PF02698|0.00021|28.6|42/155|DUF218| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccccccccEEEEcccHHHHHHHHHHcccccHHHHHccccccccccccccccccccccccEEccccccHHHHHHHHHHHHHHHHHHHccccEEEEEccccccEEEEEcccHHccccccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHccHHHHcccccccccccHHHHccccccccHHHHHHHHHHHcc //