[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57469.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:183 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   82->160 2asfA PDBj 3e-04 13.9 %
:RPS:PFM   69->161 PF04075 * DUF385 3e-17 53.8 %
:HMM:PFM   67->161 PF04075 * DUF385 9.4e-24 37.9 95/132  
:BLT:SWISS 69->182 Y1584_MYCBO 2e-10 32.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57469.1 GT:GENE BAD57469.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2792570..2793121 GB:FROM 2792570 GB:TO 2793121 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57469.1 LENGTH 183 SQ:AASEQ MMLPIPVGAPRHTGRPDRARMADMAANPLPVLARYLARQRWVMRTAPLVVRLERLVRRLTRGRYGVLDLAGLPSLELTVAGRKTGRPRTTALLYVPYGADHLVVGSNWGSAKHPVWSANLRAADRAVVHRRGERYPVRVVELTGPERKEAWAAAVRFWPGYLMECELSGGREFRMFVLQRVRE GT:EXON 1|1-183:0| BL:SWS:NREP 1 BL:SWS:REP 69->182|Y1584_MYCBO|2e-10|32.7|113/148| SEG 17->26|drarmadmaa| SEG 48->67|lvvrlerlvrrltrgrygvl| RP:PDB:NREP 1 RP:PDB:REP 82->160|2asfA|3e-04|13.9|79/124| RP:PFM:NREP 1 RP:PFM:REP 69->161|PF04075|3e-17|53.8|93/130|DUF385| HM:PFM:NREP 1 HM:PFM:REP 67->161|PF04075|9.4e-24|37.9|95/132|DUF385| OP:NHOMO 72 OP:NHOMOORG 36 OP:PATTERN -------------------------------------------------------------------- ----1---------25611-1---2311111--4444242-2-211--------------1-2-1-3211------------------------------------------------------------------1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 43.2 SQ:SECSTR #################################################################################cTTccEEEEEEccEEETTTEEEEEEETTcHHHHHHHHHcEEEEEEEETTEEEEEEEEEEEEccHHHHHHHHHHHHHHcc####################### DISOP:02AL 1-2| PSIPRED cEEEcccccccccccccHHHHHHHccccHHHHHHHcccccHHEEcccccccccEEEEEEcccEEEEEccccccEEEEEEEcccccccEEEEEEEEEEcccEEEEEccccccccccEEEEcccccEEEEEEccEEEEEEEEEcccccHHHHHHHHHHHcccHHHHHHHccccEEEEEEEEEccc //