[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57475.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:138 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57475.1 GT:GENE BAD57475.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2798534..2798950 GB:FROM 2798534 GB:TO 2798950 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57475.1 LENGTH 138 SQ:AASEQ MADRASRRSASVASMIWAWLFVALLAALAIFQIAVAAGAPLGRFTWGGAHPGVLPAGLRVAAVVSILIYAVMAALALDRAGAVELVPDDVAAAGMWVVVGFCVFSVVPNAISRSAGERYVMTPVSVALAVLALLVALG GT:EXON 1|1-138:0| TM:NTM 4 TM:REGION 14->36| TM:REGION 55->77| TM:REGION 89->111| TM:REGION 117->138| SEG 2->14|adrasrrsasvas| SEG 17->39|wawlfvallaalaifqiavaaga| SEG 97->107|vvvgfcvfsvv| SEG 124->137|vsvalavlallval| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1---------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcHHHHHHHHHHHHHHcc //