[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57477.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  48/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:111 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->76 2jscB PDBj 2e-20 65.2 %
:RPS:PDB   21->76 1bibA PDBj 4e-13 23.2 %
:RPS:SCOP  8->77 1fnnA1  a.4.5.11 * 2e-11 14.3 %
:HMM:SCOP  7->98 1u2wA1 a.4.5.5 * 3.7e-21 41.3 %
:RPS:PFM   21->65 PF01022 * HTH_5 1e-04 48.9 %
:HMM:PFM   21->65 PF01022 * HTH_5 8.6e-15 46.7 45/47  
:BLT:SWISS 11->76 CMTR_MYCTU 5e-20 65.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57477.1 GT:GENE BAD57477.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2800477..2800812 GB:FROM 2800477 GB:TO 2800812 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57477.1 LENGTH 111 SQ:AASEQ METAAVLHIDALARFGRALSDPTRARIMVRLRQQPGYPSELAEQLGVSRQILSNHLACLRGCGLVVAVPEGRRVRYELADARVGAALGDLLGLVLAVDPACCPASDERGCC GT:EXON 1|1-111:0| BL:SWS:NREP 1 BL:SWS:REP 11->76|CMTR_MYCTU|5e-20|65.2|66/118| TM:NTM 1 TM:REGION 83->105| SEG 78->100|ladarvgaalgdllglvlavdpa| BL:PDB:NREP 1 BL:PDB:REP 11->76|2jscB|2e-20|65.2|66/97| RP:PDB:NREP 1 RP:PDB:REP 21->76|1bibA|4e-13|23.2|56/294| RP:PFM:NREP 1 RP:PFM:REP 21->65|PF01022|1e-04|48.9|45/47|HTH_5| HM:PFM:NREP 1 HM:PFM:REP 21->65|PF01022|8.6e-15|46.7|45/47|HTH_5| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01022|IPR001845| GO:PFM GO:0005622|"GO:intracellular"|PF01022|IPR001845| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01022|IPR001845| RP:SCP:NREP 1 RP:SCP:REP 8->77|1fnnA1|2e-11|14.3|70/103|a.4.5.11| HM:SCP:REP 7->98|1u2wA1|3.7e-21|41.3|92/0|a.4.5.5|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 68 OP:NHOMOORG 48 OP:PATTERN -------------------------------------------------------------------- -----1-31141111--11-13--1111111-312111-2-1214111111131211-----1-----212--------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 77 STR:RPRED 69.4 SQ:SECSTR ccHHHHHEEEHHHTccHHcccHHHHHHHHHHTTcccccHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEcE################################## DISOP:02AL 1-4| PSIPRED ccccccccHHHHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEccccEEEEEEccHHHHHHHHHHHHHHHHHHHcccccccccccc //