[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57482.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:129 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57482.1 GT:GENE BAD57482.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2803798..2804187 GB:FROM 2803798 GB:TO 2804187 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57482.1 LENGTH 129 SQ:AASEQ MTQPPPPPPPVGPPPGSGSGLAVAGFAVLGAFVYICANAVFGFMVFLLVSDRPGTTGEIILGVATAAGVLTVFVGGGLLIRTRNAVAKGLGLGLMIGWALVTICTVGLCTGVNPDLYAALTWPASNGVP GT:EXON 1|1-129:0| TM:NTM 3 TM:REGION 22->44| TM:REGION 57->79| TM:REGION 88->110| SEG 4->32|pppppppvgpppgsgsglavagfavlgaf| SEG 61->79|lgvataagvltvfvgggll| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------1--------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 8-16, 127-129| PSIPRED ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHEEHHHHHHHHHHHHHcccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccc //