[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57484.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:94 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->50 PF04654 * DUF599 5.6e-06 42.3 26/216  
:HMM:PFM   68->88 PF06703 * SPC25 0.00088 47.6 21/161  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57484.1 GT:GENE BAD57484.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2805761..2806045 GB:FROM 2805761 GB:TO 2806045 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57484.1 LENGTH 94 SQ:AASEQ MSDNPGVYYTEATAKQATPDPLNLCVYATVALLTWLFGPLALIAFAVLAFVGYWRAWRHGLRRSRCLLRDTRLVLGYLALLVVIAVVAVVHPLI GT:EXON 1|1-94:0| TM:NTM 2 TM:REGION 26->48| TM:REGION 70->92| SEG 40->51|laliafavlafv| SEG 73->90|lvlgylallvviavvavv| HM:PFM:NREP 2 HM:PFM:REP 25->50|PF04654|5.6e-06|42.3|26/216|DUF599| HM:PFM:REP 68->88|PF06703|0.00088|47.6|21/161|SPC25| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------1----------1-----------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //