[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57486.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:157 amino acids
:PSIPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57486.1 GT:GENE BAD57486.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2806731..2807204 GB:FROM 2806731 GB:TO 2807204 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57486.1 LENGTH 157 SQ:AASEQ MITVVQVLAVLALAANAVVYGTDAAAALVVRSANTHLDDTAMTLSAGWGHYYADRRMPPVGITGLVSMLAAAVAAALGGHTVAAAAAGVSVIALIAWLVLYARIAKPVNIAQKAAALSGIIPANARALQQRWDSIIGVRVGLQAIALLAAAVTIAAV GT:EXON 1|1-157:0| TM:NTM 4 TM:REGION 8->30| TM:REGION 57->79| TM:REGION 83->105| TM:REGION 134->156| SEG 4->19|vvqvlavlalaanavv| SEG 64->96|glvsmlaaavaaalgghtvaaaaagvsvialia| SEG 144->156|aiallaaavtiaa| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //