[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57487.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:70 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->39 PF04031 * Las1 0.00064 34.6 26/154  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57487.1 GT:GENE BAD57487.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2807208..2807420 GB:FROM 2807208 GB:TO 2807420 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57487.1 LENGTH 70 SQ:AASEQ MVFSRARHGCAPVRRRQTHRTVPHLTVRWRTVTQRTVPWRTVPWRTVPWRTRSVRASHRRTTGIEGPMPE GT:EXON 1|1-70:0| SEG 26->43|tvrwrtvtqrtvpwrtvp| HM:PFM:NREP 1 HM:PFM:REP 13->39|PF04031|0.00064|34.6|26/154|Las1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 5-7, 63-70| PSIPRED cccccccccccccHHHHcccccccEEEEEEEccccccccccccccccccccccccccccccccccccccc //