[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57489.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:106 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   33->82 PF06738 * DUF1212 9.5e-05 24.0 50/193  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57489.1 GT:GENE BAD57489.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2809157..2809477) GB:FROM 2809157 GB:TO 2809477 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57489.1 LENGTH 106 SQ:AASEQ MAAALWIGFSGYSLYSKQPFVVEPLERYGVPRGWWNWLAAAKSAGALGLLAGLVVPAVGVAAAVGLIVYFLGAVATTIHAKSYGTTVFPLLYLAPAAAALALQLAR GT:EXON 1|1-106:0| TM:NTM 3 TM:REGION 1->23| TM:REGION 51->73| TM:REGION 84->106| SEG 38->66|laaaksagalgllaglvvpavgvaaavgl| SEG 90->105|llylapaaaalalqla| HM:PFM:NREP 1 HM:PFM:REP 33->82|PF06738|9.5e-05|24.0|50/193|DUF1212| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 31-31,34-34,39-40,45-46,48-48,81-81,87-88,90-90| PSIPRED cccEEEEEcccccccccccccccHHHHcccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcc //