[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57491.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:310 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  39->145 1s7bA_ f.39.1.1 * 6.9e-09 26.0 %
:HMM:SCOP  185->295 1s7bA_ f.39.1.1 * 2.9e-05 26.0 %
:HMM:PFM   15->138 PF00892 * EamA 5.5e-15 22.0 123/126  
:HMM:PFM   161->284 PF00892 * EamA 8.6e-19 25.6 121/126  
:BLT:SWISS 16->183 Y510_ARCFU 8e-07 24.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57491.1 GT:GENE BAD57491.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2811273..2812205 GB:FROM 2811273 GB:TO 2812205 GB:DIRECTION + GB:PRODUCT putative membrane protein GB:PROTEIN_ID BAD57491.1 LENGTH 310 SQ:AASEQ MRREPATLLPAAAALVWGASYTVTGWGLRELDVLSYNAIRFAAAAPLLFAVVLLTEGAPWVARAVWPRLAVSASIGIVAYQLTFSLAVAWTTVTEAAILIALSPLWAALFAAVAGEWVPGPVVVAALAATVGVILVVTGRPDGPPPVHRLPGDLAALTAGVLWGLYPVVTRPLLDRYSPVRVTAWAALIGGAVLLAGAALLPGARPGAAEWAALTWVSLAFSVLAVTVFGLVAWYRGVRALGSARTMLHMFAVPVVAAAFAVVGGERIGAAQILGGALVLAALAAVPTTRPDPAPPVTPASKHPVPRRIP GT:EXON 1|1-310:0| BL:SWS:NREP 1 BL:SWS:REP 16->183|Y510_ARCFU|8e-07|24.0|167/100| TM:NTM 8 TM:REGION 5->27| TM:REGION 38->60| TM:REGION 69->91| TM:REGION 94->115| TM:REGION 121->138| TM:REGION 181->203| TM:REGION 210->232| TM:REGION 257->279| SEG 5->15|patllpaaaal| SEG 41->54|faaaapllfavvll| SEG 118->138|vpgpvvvaalaatvgvilvvt| SEG 184->209|awaaliggavllagaallpgarpgaa| SEG 251->263|favpvvaaafavv| SEG 268->286|igaaqilggalvlaalaav| HM:PFM:NREP 2 HM:PFM:REP 15->138|PF00892|5.5e-15|22.0|123/126|EamA| HM:PFM:REP 161->284|PF00892|8.6e-19|25.6|121/126|EamA| HM:SCP:REP 39->145|1s7bA_|6.9e-09|26.0|104/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| HM:SCP:REP 185->295|1s7bA_|2.9e-05|26.0|104/106|f.39.1.1|2/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 36 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1------------------------------------------------------------------------------------------------------------1------------------------------------------------222221222222122------222------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 290-303, 305-310| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccc //