[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57492.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.110.9
:148 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->103 2a2lA PDBj 5e-12 22.0 %
:RPS:SCOP  2->105 2a2lA1  d.110.9.1 * 9e-15 25.5 %
:HMM:SCOP  1->140 2a2lA1 d.110.9.1 * 1.1e-24 35.3 %
:HMM:PFM   3->136 PF03928 * DUF336 3.2e-30 33.1 130/132  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57492.1 GT:GENE BAD57492.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2812202..2812648 GB:FROM 2812202 GB:TO 2812648 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57492.1 LENGTH 148 SQ:AASEQ MTSISLTAAVTIAEHAVAFGVEHGYDPLTVAVLDPGGHPVVLHRQDGSGILRPDIATAKAWGVLGLGVPNREIARRAAAAPAFFTSVAVLAQGRILDVPGGVFVRAESGTLLGAVGVTGAATSAEDELAAIAGIRAAGLVPETGAPST GT:EXON 1|1-148:0| SEG 74->82|arraaaapa| SEG 108->124|sgtllgavgvtgaatsa| SEG 128->139|laaiagiraagl| RP:PDB:NREP 1 RP:PDB:REP 1->103|2a2lA|5e-12|22.0|100/145| HM:PFM:NREP 1 HM:PFM:REP 3->136|PF03928|3.2e-30|33.1|130/132|DUF336| RP:SCP:NREP 1 RP:SCP:REP 2->105|2a2lA1|9e-15|25.5|102/142|d.110.9.1| HM:SCP:REP 1->140|2a2lA1|1.1e-24|35.3|133/0|d.110.9.1|1/1|GlcG-like| OP:NHOMO 30 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1------1------------------------2-------------------1--------1--------1--------------------------------------11------------1-----------------------1---------------1------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111112111-----------------1----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 100 STR:RPRED 67.6 SQ:SECSTR cccccHHHHHHHHHHHHHHHHHTTc#ccEEEEEETTccEEEEEEcTTccTTHHHHHHHHHHHHHHTTccGGGcGGGccTTcTTTTGGGcG##GGTccccccEE############################################# DISOP:02AL 144-148| PSIPRED cccccHHHHHHHHHHHHHHHHHccccEEEEEEEcccccEEEEEEccccccccHHHHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHcccccEEEEEccEEEEEEccEEEEEEEEcccccHHHHHHHHHHHHHHcccccccccccc //