[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57494.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:152 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->102 PF03547 * Mem_trans 0.00064 18.1 94/385  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57494.1 GT:GENE BAD57494.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2814658..2815116) GB:FROM 2814658 GB:TO 2815116 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57494.1 LENGTH 152 SQ:AASEQ MQGAGAALVVATSVPPLWFLVLGEADRIAGMNATIFAAYAILGAAAALCAIPLLFTSHRAPAWLRHTAVTILSLSAAGFVALGALAAFREPAGITVAIAFEFGIFGCASAVLAYRLQTSSRAVEVPGPSPEQRQAQLRERFTELRSRRSPGS GT:EXON 1|1-152:0| TM:NTM 4 TM:REGION 2->24| TM:REGION 33->55| TM:REGION 64->86| TM:REGION 94->116| SEG 33->54|atifaayailgaaaalcaipll| SEG 72->88|lslsaagfvalgalaaf| HM:PFM:NREP 1 HM:PFM:REP 8->102|PF03547|0.00064|18.1|94/385|Mem_trans| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 121-152| PSIPRED ccccccEEEEEEccccEEEEEEcccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEHHHHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHHHHHcccccc //