[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57495.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:177 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->80 PF06895 * DUF1267 0.00016 29.5 61/74  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57495.1 GT:GENE BAD57495.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2815160..2815693) GB:FROM 2815160 GB:TO 2815693 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57495.1 LENGTH 177 SQ:AASEQ MDFSIEEFEEVVRNIEEKLDGLDSQLASVPGIAQFAYRAAATAHNAAAKRISDISKDAATTLIVSAAAGLTFYAVILGVLVKAAMAVTVGLGGIASGVFSWAGAALIVEEAITDSAAIAAAIAGLTALLTAQVTTMAGLEATATDNSTWPNGKWPDAATSTFDNGTRLDGTAEWSIR GT:EXON 1|1-177:0| TM:NTM 3 TM:REGION 23->45| TM:REGION 69->91| TM:REGION 115->137| SEG 5->17|ieefeevvrniee| SEG 36->48|ayraaatahnaaa| SEG 111->131|aitdsaaiaaaiagltallta| HM:PFM:NREP 1 HM:PFM:REP 9->80|PF06895|0.00016|29.5|61/74|DUF1267| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEcccccccccccccccccccccccccccccccccccc //