[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57496.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:105 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   12->69 PF06386 * GvpL_GvpF 2.2e-05 17.2 58/250  
:HMM:PFM   63->94 PF00455 * DeoR 0.00041 37.5 32/157  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57496.1 GT:GENE BAD57496.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2815719..2816036) GB:FROM 2815719 GB:TO 2816036 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57496.1 LENGTH 105 SQ:AASEQ MPPRPTAERIKVATDNLRAESRVWTTESGTLTAISHAISRLKFNRTEAGMFQLIVTAHSNLVDKAAERCQEGSTAFADTGSTLNKVANTYDEEDRLYAERLANIW GT:EXON 1|1-105:0| HM:PFM:NREP 2 HM:PFM:REP 12->69|PF06386|2.2e-05|17.2|58/250|GvpL_GvpF| HM:PFM:REP 63->94|PF00455|0.00041|37.5|32/157|DeoR| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //